KEGG   T30397 (Metagenome): 13373
Entry
13373             CDS       T30397                                 

Gene name
dapA
Definition
dihydrodipicolinate synthase
  KO
K01714  4-hydroxy-tetrahydrodipicolinate synthase [EC:4.3.3.7]
Best hit
vpr:Vpar_0930 (best score: 71.6329)
Pathway
00261  Monobactam biosynthesis
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.13373-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_18936:1..138
AA seq 46 aa
VGSNDTMASAEFVKEVSKIDGIDGLLVVVPYYNKPNQQGQXXXXXX

KEGG   T30397 (Metagenome): 1897
Entry
1897              CDS       T30397                                 

Definition
hypothetical protein
  KO
K01714  4-hydroxy-tetrahydrodipicolinate synthase [EC:4.3.3.7]
Best hit
vpr:Vpar_0930 (best score: 234.958)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00261  Monobactam biosynthesis
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.1897-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_5223:complement(822..1220)
AA seq 132 aa
IKEASGNLMIASEIKRLIPGDDFMVYSGDDGLTLPMLSVGACGVVSVVSHVAGKDMNAMI
QAYESGHNHEALRIHQSLADIIKAMFITTNPIPVKYAARKIGLPAGVFNLPMCDPSADEA
AYIDKALAEYVK

KEGG   T30397 (Metagenome): 21109
Entry
21109             CDS       T30397                                 

Gene name
dapA
Definition
dihydrodipicolinate synthase
  KO
K01714  4-hydroxy-tetrahydrodipicolinate synthase [EC:4.3.3.7]
Best hit
vpr:Vpar_0930 (best score: 85.1149)
Pathway
00261  Monobactam biosynthesis
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.21109-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_24564:1079..1210
AA seq 44 aa
MKTFGRVLTAMVTSFNSDGSANIENCVAIANHLLDNGSDGLVVC

KEGG   T30397 (Metagenome): 24257
Entry
24257             CDS       T30397                                 

Gene name
dapA
Definition
dihydrodipicolinate synthase
  KO
K01714  4-hydroxy-tetrahydrodipicolinate synthase [EC:4.3.3.7]
Best hit
vpr:Vpar_0930 (best score: 99.7525)
Pathway
00261  Monobactam biosynthesis
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.24257-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_26768:complement(2..172)
AA seq 57 aa
MKTFGRVLTAMITSFNNDGSLNIENSVAIAHHLLDNGSDGLVVCGTTGENPSMSKED

KEGG   T30397 (Metagenome): 28341
Entry
28341             CDS       T30397                                 

Gene name
dapA
Definition
dihydrodipicolinate synthase
  KO
K01714  4-hydroxy-tetrahydrodipicolinate synthase [EC:4.3.3.7]
Best hit
spn:SP_1014 (best score: 157.532)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00261  Monobactam biosynthesis
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.28341-T1-C
LinkDB
Position
C906130:complement(70..306)
AA seq 78 aa
KAAAIQRKFIPKVNALFSYPSPAPVKAVLNYMGFEAGPTRLPLVPAPEEDAKRIIKVVVD
GDYEATKATVTGVLRPDY

KEGG   T30397 (Metagenome): 7108
Entry
7108              CDS       T30397                                 

Gene name
dapA
Definition
dihydrodipicolinate synthase
  KO
K01714  4-hydroxy-tetrahydrodipicolinate synthase [EC:4.3.3.7]
Best hit
spn:SP_1014 (best score: 69.707)
Pathway
00261  Monobactam biosynthesis
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.7108-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_14075:2..121
AA seq 40 aa
IPNLIEHLLAHHTDGILLAGTTAESPTLTHDEELXXXXXX

KEGG   T30397 (Metagenome): 7109
Entry
7109              CDS       T30397                                 

Gene name
dapA
Definition
dihydrodipicolinate synthase
  KO
K01714  4-hydroxy-tetrahydrodipicolinate synthase [EC:4.3.3.7]
Best hit
spn:SP_1014 (best score: 83.9593)
Pathway
00261  Monobactam biosynthesis
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.7109-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_14075:184..315
AA seq 44 aa
XXXXFAAGLAIVPYYNKPSQEGMYQHFKAIADASDLPIIIYNIP

KEGG   T30397 (Metagenome): 9873
Entry
9873              CDS       T30397                                 

Definition
hypothetical protein
  KO
K01714  4-hydroxy-tetrahydrodipicolinate synthase [EC:4.3.3.7]
Best hit
apv:Apar_0929 (best score: 41.2022)
Pathway
00261  Monobactam biosynthesis
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.9873-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_16285:complement(217..303)
AA seq 29 aa
ADALVATAPFYALGGPADIEEXXXXXXXX

DBGET integrated database retrieval system