KEGG   T30397 (Metagenome): 1339
Entry
1339              CDS       T30397                                 

Definition
hypothetical protein
  KO
K03475  ascorbate PTS system EIIC component
Best hit
vpr:Vpar_1346 (best score: 116.316)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00053  Ascorbate and aldarate metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
02060  Phosphotransferase system (PTS)
Other DBs
HMP: SRS019024.1339-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_3814:complement(131..331)
AA seq 67 aa
KVLGVETMSILVVGLLMNLCIARFTKFKYVFLTGHHSLFMACLMSAVLGTAGLSGMELIX
XXXXXXX

KEGG   T30397 (Metagenome): 16630
Entry
16630             CDS       T30397                                 

Definition
ascorbate-specific PTS system enzyme IIC
  KO
K03475  ascorbate PTS system EIIC component
Best hit
spy:SPy_0174 (best score: 213.386)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00053  Ascorbate and aldarate metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
02060  Phosphotransferase system (PTS)
Other DBs
HMP: SRS019024.16630-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_21317:complement(1..414)
AA seq 138 aa
LQNPAFFVGLLVLIGYALLKKPAHDVFSGFVKATVGYMLLNVGAGGLVTTFRPILAALNY
KFQIGAAVIDPYFGLAAANNKIAAEFPDFVGTATTALLIGFGINILLVALRKITKVRTLF
ITGHIMVQQAATVSLMVL

KEGG   T30397 (Metagenome): 18298
Entry
18298             CDS       T30397                                 

Definition
transport protein sgaT protein
  KO
K03475  ascorbate PTS system EIIC component
Best hit
adc:FOC79_07600 (best score: 121.324)
Taxonomy
Firmicutes - Bacilli [GN:adc]
Pathway
00053  Ascorbate and aldarate metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
02060  Phosphotransferase system (PTS)
Other DBs
HMP: SRS019024.18298-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_22529:complement(236..445)
AA seq 70 aa
GVRLFVAELSEAFQGISNKLLPGSMPAVDCAAVYGFGSPNAVTVGFLFGVLGQILAILGL
IVFXXXXXXX

KEGG   T30397 (Metagenome): 23850
Entry
23850             CDS       T30397                                 

Definition
putative membrane protein
  KO
K03475  ascorbate PTS system EIIC component
Best hit
vpr:Vpar_1346 (best score: 180.644)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00053  Ascorbate and aldarate metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
02060  Phosphotransferase system (PTS)
Other DBs
HMP: SRS019024.23850-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_26492:3..350
AA seq 116 aa
LIPAFQGIATKIIPNAIPAVDCAVFFTYAPTAVVLGFLSSFIGGIIGMLILGAVGGVLII
PGLVPHFFCGATAGIYGNATGGRRGAAVGAFLNGLAITFLPALALPVLGQLGFQNT

KEGG   T30397 (Metagenome): 27976
Entry
27976             CDS       T30397                                 

Definition
putative PTS system, membrane component
  KO
K03475  ascorbate PTS system EIIC component
Best hit
spy:SPy_0174 (best score: 499.975)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00053  Ascorbate and aldarate metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
02060  Phosphotransferase system (PTS)
Other DBs
HMP: SRS019024.27976-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_29217:1..942
AA seq 314 aa
LVPQLRNAYGTAAIGIICGLYWAVSSNMTVEATQRLTGGGGFAIGHQQQFAIWFVDKVAG
RFGKKEESLDNLKLPKFLSIFHDTVVASATLMLVFFGAILLILGPDIMSNKEVITSGTLF
NPAKQDFFMYIIQTAFTFSVYLFVLMQGVRMFXXXXXXXXISSKLLPGSFPAVDVAASYG
FGSPNAVLSGFAFGLIGQLITIVLLIVFKNPILIITGFVPVFFDNAAIAVYADKRGGWKA
AVILSFISGVLQVALGALCVALLDLASYGGYHGNIDFEFPWLGFGYIFKYLGIVGYVLVC
LFLLVIPQLQFAKS

KEGG   T30397 (Metagenome): 31322
Entry
31322             CDS       T30397                                 

Definition
putative membrane protein
  KO
K03475  ascorbate PTS system EIIC component
Best hit
vpr:Vpar_1346 (best score: 306.99)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00053  Ascorbate and aldarate metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
02060  Phosphotransferase system (PTS)
Other DBs
HMP: SRS019024.31322-T1-C
LinkDB
Position
C915987:1..489
AA seq 163 aa
YIGGSAMEMVLEFLRDVLSQPALLIGIMSCIGLIALKRPFHKIMTGTLKPILGYLMLAAG
AGVIVSNLDPLGKMIEHGFHITGVVPNNEAIVAVAQKVLGVETMSILVVGLLMNLCIARF
TKFKYVFLTGHHSLFMACLMSAVLGTAGLSGMELILVGGFLMG

KEGG   T30397 (Metagenome): 33165
Entry
33165             CDS       T30397                                 

Definition
PTS system, IIC component
  KO
K03475  ascorbate PTS system EIIC component
Best hit
aur:HMPREF9243_0263 (best score: 621.313)
Taxonomy
Firmicutes - Bacilli [GN:aur]
Pathway
00053  Ascorbate and aldarate metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
02060  Phosphotransferase system (PTS)
Other DBs
HMP: SRS019024.33165-T1-C
LinkDB
Position
C920176:complement(1492..2838)
AA seq 448 aa
MMKFILDIVSTPAILVALIAILGLVLQKKKLPDIIKGGIKTFVGFLVVSGGAGIVQNSLN
PFGTMFEHAFHLSGVVPNNEAIVAVALTTYGSATAMIMFAGMVFNILIARFTRFKYIFLT
GHHTLYMACMIAVILSVAGFTSLPLILLGGLALGIIMSVSPAFVQKYMVQLTGNDKVALG
HFSSLGYWLSGFTGSLIGDKSKSTEDIKFPKSLAFLRDSTVSITLSMAIIYIIVAIFAGS
EYIEKEISSGTSGLVYALQLAGQFAAGVFVILAGVRLILGEIVPAFKGISERLVPNSKPA
LDCPIVYTYAPNAVLIGFISSFVGGLVSMAIMIASGTVVILPGVVPHFFCGATAGVIGNA
SGGVRGATIGAFLQGILISFLPVFLMPVLGGLGFQGSTFSDADFGLSGIILGMLNQFGSQ
AGIVIGLVLILAVMFGVSFIKKPSAKEE

DBGET integrated database retrieval system