KEGG   T30397 (Metagenome): 13563
Entry
13563             CDS       T30397                                 

Definition
aspartate-semialdehyde dehydrogenase
  KO
K00133  aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Best hit
pru:PRU_0050 (best score: 77.7962)
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.13563-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_19092:complement(203..361)
AA seq 53 aa
SAGHDDIYVGRIRKDLADDNGNTLWLTGDQIRKGAALNAVQIAEYXXXXXXXX

KEGG   T30397 (Metagenome): 1827
Entry
1827              CDS       T30397                                 

Definition
hypothetical protein
  KO
K00133  aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Best hit
leu:Leucomu_11915 (best score: 51.6026)
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.1827-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_5047:3..116
AA seq 38 aa
CAMLDQRDFPVKSLRLFSSARSAGSVVTWRGQXXXXXX

KEGG   T30397 (Metagenome): 1828
Entry
1828              CDS       T30397                                 

Definition
aspartate-semialdehyde dehydrogenase
  KO
K00133  aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Best hit
fsl:EJO69_09490 ksk:KSE_20800 (best score: 55.8398)
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.1828-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_5047:223..312
AA seq 30 aa
XDNSSAWRKDPQVPLVVAEVNPQALAQRPK

KEGG   T30397 (Metagenome): 21108
Entry
21108             CDS       T30397                                 

Gene name
asd
Definition
aspartate-semialdehyde dehydrogenase
  KO
K00133  aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Best hit
vpr:Vpar_0929 (best score: 479.944)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.21108-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_24564:151..990
AA seq 280 aa
VQGDVSMKKPNIAILGATGAVGAEFITLIEERNFPYENLKLLASARSAGTELTVNGKTYI
VEEAKPESFDNIDIALFAGGSISKTLAPEAAKRGAIVXXXXXXXXXXNPNCSTIIMSLGL
KPLHDLSPIKRVVVSTYQAVSGAGKEGIEELENQVKQYTAGEEMTANLLPTGSAPKHYPV
AFNLLPQIDVFLENDYTKEEMKMVYETQKILHDETIQVVPTTVRVPVYRSHSESVLVETA
EPVSVEAFKVACEKFPGLQVKDNPAEQIYPMPLYXXXXXX

KEGG   T30397 (Metagenome): 24258
Entry
24258             CDS       T30397                                 

Gene name
asd
Definition
aspartate-semialdehyde dehydrogenase
  KO
K00133  aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Best hit
vpr:Vpar_0929 (best score: 486.493)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.24258-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_26768:complement(253..1056)
AA seq 268 aa
XXXGGSISKTLAPEAAKRGAIVIDNSSAFRMDPEVPLVVPEVNPEDILKHKGIIANPNCS
TIIMSLGLKPLHDISPIKRIVVSTYQAVSGAGKEGIEELENQVKQYTAGEEMTANLLPTG
SAPKHYPVAFNLLPQIDVFLDNDYTKEEMKMVHETQKILHDDTIQVVPTTVRVPVYRSHS
ESVLVETEEPVSVEAFKAACEKFPGLQVKDNPAEQIYPMPLYTSNQNDCEIGRIRKDLYN
DKGMNFWIVGDQIRKGAALNXXXXXXXX

KEGG   T30397 (Metagenome): 24259
Entry
24259             CDS       T30397                                 

Definition
hypothetical protein
  KO
K00133  aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Best hit
vpr:Vpar_0929 (best score: 124.405)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.24259-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_26768:complement(1110..1316)
AA seq 69 aa
MKKPNVAILGATGAVGAEFITLIEERNFPYENLKLLASARSAGTELTVNGKTYVVEEAKP
ESFXXXXXX

KEGG   T30397 (Metagenome): 30404
Entry
30404             CDS       T30397                                 

Gene name
asd
Definition
aspartate-semialdehyde dehydrogenase
  KO
K00133  aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Best hit
spn:SP_1013 (best score: 247.284)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.30404-T1-C
LinkDB
Position
C913029:1..396
AA seq 132 aa
LEPVRQKWGLDRIIVSTYQAVSGAGMGAILETQRELREVLNDGVKPRDLHAEILPSGGDK
KHYPIAFNALPQIDVFTDNDYTYEEMKMTKETKKIMEDDSIAVSATCVRIPVLSAHSESV
YIETKEVAPIEE

KEGG   T30397 (Metagenome): 9256
Entry
9256              CDS       T30397                                 

Definition
aspartate-semialdehyde dehydrogenase
  KO
K00133  aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Best hit
fhw:RN87_06580 (best score: 74.7146)
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.9256-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_15792:complement(3..113)
AA seq 37 aa
XKKGFIVVKPNCSIQSYVPVFAAIKEFGIKEASICTY

KEGG   T30397 (Metagenome): 9257
Entry
9257              CDS       T30397                                 

Definition
aspartate-semialdehyde dehydrogenase
  KO
K00133  aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Best hit
fhw:RN87_06580 (best score: 67.781)
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.9257-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_15792:complement(173..334)
AA seq 54 aa
LIFCAVNLDKKELVALEEAYAKEEVVVVSNNSANRMKADVPMIIPEIXXXXXXX

KEGG   T30397 (Metagenome): 9277
Entry
9277              CDS       T30397                                 

Definition
aspartate-semialdehyde dehydrogenase
  KO
K00133  aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Best hit
rmu:RMDY18_04100 (best score: 159.458)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.9277-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_15804:74..322
AA seq 83 aa
MFRSEYQIFCTVLSRMRQPESTLGTMNFNPGDSVGFVGWRGMVGSVLMKRMVEEGDFEGI
TPVFFTTSNVGGQAPTXXXXXXX

KEGG   T30397 (Metagenome): 9278
Entry
9278              CDS       T30397                                 

Gene name
asd
Definition
aspartate-semialdehyde dehydrogenase
  KO
K00133  aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Best hit
rmu:RMDY18_04100 (best score: 54.299)
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.9278-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_15804:358..465
AA seq 36 aa
XDELRKHSIIVTAQGGGYTEAVHPKLRAAXXXXXXX

KEGG   T30397 (Metagenome): 9279
Entry
9279              CDS       T30397                                 

Definition
aspartate-semialdehyde dehydrogenase
  KO
K00133  aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Best hit
rmu:RMDY18_04100 (best score: 85.8853)
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.9279-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_15804:537..686
AA seq 50 aa
XXXWIDAASTLRMNDDSIIVLDPINRDVIDRGLASGVKDYIGGNXXXXXX

KEGG   T30397 (Metagenome): 9280
Entry
9280              CDS       T30397                                 

Definition
aspartate-semialdehyde dehydrogenase
  KO
K00133  aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Best hit
rmu:RMDY18_04100 (best score: 216.083)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.9280-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_15804:849..1331
AA seq 160 aa
VPLSGSLIPWIDSDLGNGQSREEWKAEVETNKILGRSADDKVTMDGLCVRIAAMRSHSQA
LTIKLKKDLPLEEIERIIAEDNPWVRFVPNEREASMEQLTPVAASGSLEIXXXXXXXXXX
SWPWAPSTLARSPWVTSCCGVPPSRFAACCRLPWASSKAR

DBGET integrated database retrieval system