KEGG   T30397 (Metagenome): 13651
Entry
13651             CDS       T30397                                 

Gene name
fda
Definition
fructose-bisphosphate aldolase class 1
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Best hit
fnu:FN0322 (best score: 79.3369)
Pathway
00010  Glycolysis / Gluconeogenesis
00030  Pentose phosphate pathway
00051  Fructose and mannose metabolism
00680  Methane metabolism
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04066  HIF-1 signaling pathway
Other DBs
HMP: SRS019024.13651-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_19153:3..143
AA seq 47 aa
RDEIRKHLNALPETSNVMLKLTLPTVENFYEEFTKHPRVVXXXXXXX

KEGG   T30397 (Metagenome): 13407
Entry
13407             CDS       T30397                                 

Gene name
fbaA
Definition
fructose-bisphosphate aldolase, class II
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Best hit
rmu:RMDY18_00820 (best score: 524.628)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00010  Glycolysis / Gluconeogenesis
00030  Pentose phosphate pathway
00051  Fructose and mannose metabolism
00680  Methane metabolism
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.13407-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_18964:428..1270
AA seq 281 aa
MAIATPEVYAEMLQRAKEQGFAYPAVNVTSSQTLNAAIRGFAEAGSDGIIQASTGGAAYW
SGASKKDMVVGSLAFAAYAREVAKQYDVNIALHTDHCPKDKLEGFVLPLLAESEKAVARG
EDPIFNSHMWDGSAIDLDENLKIASELIERTSKAKIVLEVEIGAVGGEEDGVEGAIDDSL
YTTVADAIKTVEAIGLGEKGTYMAALTFGNVHGVYKPGNVHLRPELLKEIQTEVGAKYGK
GDKPFYLVFHGGSGSTEQEIADAVSYGVIKMNIDTDTQYAF

KEGG   T30397 (Metagenome): 18327
Entry
18327             CDS       T30397                                 

Definition
fructose-bisphosphate aldolase, class II
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Best hit
aap:NT05HA_1725 (best score: 304.679)
Taxonomy
Gammaproteobacteria - Others [GN:aap]
Pathway
00010  Glycolysis / Gluconeogenesis
00030  Pentose phosphate pathway
00051  Fructose and mannose metabolism
00680  Methane metabolism
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.18327-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_22546:3..449
AA seq 148 aa
PVSPNFTVAAAFGNVHGVYKPGNVKLKPSILGASQEFVAKERNLPAKPINFVFHGGSGSS
REEIREAISYGAIKMNIDTDTQWAAWNGILNFYKANEAYLQGQLGNPEGPDAPNKKYYDP
RVWLRKMEESMSKRLEQSFEDLNCVDVL

KEGG   T30397 (Metagenome): 25519
Entry
25519             CDS       T30397                                 

Definition
hypothetical protein
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Best hit
dco:SAMEA4475696_2374 (best score: 49.6766)
Pathway
00010  Glycolysis / Gluconeogenesis
00030  Pentose phosphate pathway
00051  Fructose and mannose metabolism
00680  Methane metabolism
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.25519-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_27633:complement(297..386)
AA seq 30 aa
DGEVGNKKQYDPRAWGKAAEEGXXXXXXXX

KEGG   T30397 (Metagenome): 10103
Entry
10103             CDS       T30397                                 

Definition
hypothetical protein
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Best hit
ova:OBV_22970 (best score: 90.8929)
Pathway
00010  Glycolysis / Gluconeogenesis
00030  Pentose phosphate pathway
00051  Fructose and mannose metabolism
00680  Methane metabolism
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.10103-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_16460:227..391
AA seq 55 aa
XDASAHPFAENVKITKQVVEYAHDHGVVVEAELGKLAGVEDDVKVAAKDASYTDP

KEGG   T30397 (Metagenome): 7859
Entry
7859              CDS       T30397                                 

Gene name
fbaA
Definition
fructose-bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Best hit
cgl:NCgl2673 (best score: 86.2705)
Pathway
00010  Glycolysis / Gluconeogenesis
00030  Pentose phosphate pathway
00051  Fructose and mannose metabolism
00680  Methane metabolism
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.7859-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_14717:194..334
AA seq 47 aa
XXXHTDHCQKHVLDEYVRPLIAISQERVDQGLPPLFQSHMWDGSAIP

KEGG   T30397 (Metagenome): 25332
Entry
25332             CDS       T30397                                 

Gene name
fba
Definition
fructose-1,6-bisphosphate aldolase, class II
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Best hit
vpr:Vpar_1150 (best score: 227.639)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00010  Glycolysis / Gluconeogenesis
00030  Pentose phosphate pathway
00051  Fructose and mannose metabolism
00680  Methane metabolism
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.25332-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_27500:269..613
AA seq 114 aa
LKKVGELLPNFPIVLHGASSVLPEFVAKCNEFGGNIPGAQGVPEEMLRQAAQMAVCKINI
DTDLRLAMTASVREYLAQNPSEFDPRKYLGPARDAIKGMVAHKIKNVLGSSNKL

KEGG   T30397 (Metagenome): 4464
Entry
4464              CDS       T30397                                 

Definition
fructose-bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Best hit
mhg:MHY_17090 (best score: 61.2326)
Pathway
00010  Glycolysis / Gluconeogenesis
00030  Pentose phosphate pathway
00051  Fructose and mannose metabolism
00680  Methane metabolism
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.4464-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_10899:complement(3..107)
AA seq 35 aa
XXXEHPDHFDPRQYLGDGRANVKAIVAHKITEVLG

KEGG   T30397 (Metagenome): 14901
Entry
14901             CDS       T30397                                 

Definition
fructose-bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Best hit
psac:PSM36_1889 (best score: 79.7221)
Pathway
00010  Glycolysis / Gluconeogenesis
00030  Pentose phosphate pathway
00051  Fructose and mannose metabolism
00680  Methane metabolism
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.14901-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_20071:3..143
AA seq 47 aa
PAFNFNNMEQLQAIISAAVETKSPVILQVSSGARKYANQTLXXXXXX

KEGG   T30397 (Metagenome): 4465
Entry
4465              CDS       T30397                                 

Definition
fructose-1,6-bisphosphate aldolase, class II
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Best hit
rbp:B6259_00415 (best score: 81.2629)
Pathway
00010  Glycolysis / Gluconeogenesis
00030  Pentose phosphate pathway
00051  Fructose and mannose metabolism
00680  Methane metabolism
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.4465-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_10899:complement(165..314)
AA seq 50 aa
GAYKFKPGTNPELRLDILEEVKKRLPGFPIVLHGASSVPQEYXXXXXXXX

KEGG   T30397 (Metagenome): 25331
Entry
25331             CDS       T30397                                 

Gene name
fba
Definition
fructose-1,6-bisphosphate aldolase, class II
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Best hit
vpr:Vpar_1150 (best score: 124.79)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00010  Glycolysis / Gluconeogenesis
00030  Pentose phosphate pathway
00051  Fructose and mannose metabolism
00680  Methane metabolism
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.25331-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_27500:3..272
AA seq 89 aa
DFDENVKITKQVVEYAHAHGVVVEAELGRLAGVEDDVNVSDADARFTDPEQAAEFVHLTG
VDSXXXXXXXXXXTVLINLKATLTLTSTV

KEGG   T30397 (Metagenome): 23529
Entry
23529             CDS       T30397                                 

Definition
hypothetical protein
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Best hit
vpr:Vpar_1150 (best score: 225.328)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00010  Glycolysis / Gluconeogenesis
00030  Pentose phosphate pathway
00051  Fructose and mannose metabolism
00680  Methane metabolism
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.23529-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_26261:complement(3..368)
AA seq 122 aa
MTGPMAKEDNMPLVTTTEMFKKAYEGGYAVGAFNVNNMEIVQGIVDAAKEEQSPLILQVS
AGARKYAKHIYLVKLVEAALEDSNLPIALHLDHGDSFEICKDCVDGGFTSVMIDASHHDF
DE

KEGG   T30397 (Metagenome): 16811
Entry
16811             CDS       T30397                                 

Definition
hypothetical protein
  KO
K11645  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Best hit
pro:HMPREF0669_01335 (best score: 220.32)
Taxonomy
Bacteroidetes [GN:pro]
Pathway
00010  Glycolysis / Gluconeogenesis
00030  Pentose phosphate pathway
00051  Fructose and mannose metabolism
00680  Methane metabolism
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.16811-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_21455:236..589
AA seq 118 aa
XXXLNISANGNFGRSDNLTDNTTYLYERNTAADTLTSGTLRNNTKSNGKNYHVSADLTRR
IGKAGASFTVKATLGGNSNETNNTSLSLTKFHHLRNAVGGDSLLLRNLCQQLPTLRNE

DBGET integrated database retrieval system