KEGG   T30397 (Metagenome): 16066
Entry
16066             CDS       T30397                                 

Definition
Zn-dependent alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Best hit
rmu:RMDY18_08320 (best score: 353.984)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00010  Glycolysis / Gluconeogenesis
00071  Fatty acid degradation
00350  Tyrosine metabolism
00625  Chloroalkane and chloroalkene degradation
00626  Naphthalene degradation
00830  Retinol metabolism
00980  Metabolism of xenobiotics by cytochrome P450
00982  Drug metabolism - cytochrome P450
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01220  Degradation of aromatic compounds
Other DBs
HMP: SRS019024.16066-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_20903:complement(108..698)
AA seq 196 aa
MCKETMKAVVVPEKVDGSVEVREVPVPEVGHGQALVKIEYSGVCHTDLHVAAGDFGELPG
RILGHEGVGRVVKVGEGVESLKEGDRVSVAWFFEGCGHCEYCTSGRETLCRSVKNAGYTV
DGAMSEYTLVPADYAVKVPEGLDPAQASSITCAGVTTYKATKESLVRPGQWLVAYGAGGL
GNLAVQYAXRQAGSGS

KEGG   T30397 (Metagenome): 26324
Entry
26324             CDS       T30397                                 

Definition
alcohol dehydrogenase, iron-dependent
  KO
K13954  alcohol dehydrogenase [EC:1.1.1.1]
Best hit
ssq:SSUD9_1193 (best score: 141.354)
Taxonomy
Firmicutes - Bacilli [GN:ssq]
Pathway
00010  Glycolysis / Gluconeogenesis
00071  Fatty acid degradation
00350  Tyrosine metabolism
00625  Chloroalkane and chloroalkene degradation
00626  Naphthalene degradation
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01220  Degradation of aromatic compounds
Other DBs
HMP: SRS019024.26324-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_28180:complement(3..227)
AA seq 75 aa
XXXMATFYVPAVNLIGKGVVNEVGPYIKELGYKKALLVTDKFIEASDILPKVLKPLEAEG
IDYVIFSDVEPNPTC

KEGG   T30397 (Metagenome): 23388
Entry
23388             CDS       T30397                                 

Definition
alcohol dehydrogenase II
  KO
K13954  alcohol dehydrogenase [EC:1.1.1.1]
Best hit
adc:FOC79_06295 (best score: 153.68)
Taxonomy
Firmicutes - Bacilli [GN:adc]
Pathway
00010  Glycolysis / Gluconeogenesis
00071  Fatty acid degradation
00350  Tyrosine metabolism
00625  Chloroalkane and chloroalkene degradation
00626  Naphthalene degradation
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01220  Degradation of aromatic compounds
Other DBs
HMP: SRS019024.23388-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_26162:complement(212..463)
AA seq 84 aa
SLGGGSPQDAASCISVIATNGGKPQDYEGLHKSAKKGLPVVAINTTAGTSAEITINYVIT
DEERKVKMVMVDKNSLALXXXXXX

KEGG   T30397 (Metagenome): 27061
Entry
27061             CDS       T30397                                 

Definition
NAD-dependent methanol dehydrogenase
  KO
K13954  alcohol dehydrogenase [EC:1.1.1.1]
Best hit
spn:SP_2157 (best score: 420.239)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00010  Glycolysis / Gluconeogenesis
00071  Fatty acid degradation
00350  Tyrosine metabolism
00625  Chloroalkane and chloroalkene degradation
00626  Naphthalene degradation
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01220  Degradation of aromatic compounds
Other DBs
HMP: SRS019024.27061-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_28662:1..651
AA seq 216 aa
ALISVNDPELMLSKPKGLTAATGMDALTHAVEALVTPGAYDVTKKLSIGAIELIKEYLPR
AVANGQDIEAREGMVNAIFLGGMSFNNAGLGYVHSMAHQLGAVYNLPHGVCCAMLLPVVE
RENAKRVPEAFRNVAKALGLHVEGKTDQECADYAIAEIEKLSETVGIPKKLTELGIQEKD
FDFDYLSKNALIDACAPGNPFMPTLEETIALYKELF

KEGG   T30397 (Metagenome): 4757
Entry
4757              CDS       T30397                                 

Definition
alcohol dehydrogenase groES-like domain
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Best hit
ppc:HMPREF9154_1013 (best score: 33.8834)
Pathway
00010  Glycolysis / Gluconeogenesis
00071  Fatty acid degradation
00350  Tyrosine metabolism
00625  Chloroalkane and chloroalkene degradation
00626  Naphthalene degradation
00680  Methane metabolism
00830  Retinol metabolism
00980  Metabolism of xenobiotics by cytochrome P450
00982  Drug metabolism - cytochrome P450
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01220  Degradation of aromatic compounds
05204  Chemical carcinogenesis
Other DBs
HMP: SRS019024.4757-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_11435:complement(2..79)
AA seq 26 aa
MGHEYVGEVVEVGAAVTSVKPGDFVV

KEGG   T30397 (Metagenome): 13081
Entry
13081             CDS       T30397                                 

Definition
S-(hydroxymethyl)glutathione dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Best hit
bhud:A6A11_06180 hin:HI0185 aat:D11S_0481 nme:NMB1304 fcd:110856129
(best score: 73.1738)
Pathway
00010  Glycolysis / Gluconeogenesis
00071  Fatty acid degradation
00350  Tyrosine metabolism
00625  Chloroalkane and chloroalkene degradation
00626  Naphthalene degradation
00680  Methane metabolism
00830  Retinol metabolism
00980  Metabolism of xenobiotics by cytochrome P450
00982  Drug metabolism - cytochrome P450
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01220  Degradation of aromatic compounds
05204  Chemical carcinogenesis
Other DBs
HMP: SRS019024.13081-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_18732:complement(208..339)
AA seq 44 aa
WGQSIIIGVAGAGQEISTRPFQLVTGRVWKGSAFGGXXXXXXXX

KEGG   T30397 (Metagenome): 24759
Entry
24759             CDS       T30397                                 

Definition
hypothetical protein
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Best hit
cbol:CGC65_30515 (best score: 92.4337)
Pathway
00010  Glycolysis / Gluconeogenesis
00071  Fatty acid degradation
00350  Tyrosine metabolism
00620  Pyruvate metabolism
00625  Chloroalkane and chloroalkene degradation
00626  Naphthalene degradation
00650  Butanoate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01220  Degradation of aromatic compounds
05146  Amoebiasis
Other DBs
HMP: SRS019024.24759-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_27114:3..203
AA seq 67 aa
GAYFLTPAETEKVRKTIIINGALNAKIVGQKASKIAELAGCKVPEDAKVLIGEVQSVDLA
XXXXXXX

KEGG   T30397 (Metagenome): 21176
Entry
21176             CDS       T30397                                 

Definition
alcohol dehydrogenase, iron-dependent
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Best hit
spz:M5005_Spy0039 (best score: 110.538)
Taxonomy
Firmicutes - Bacilli [GN:spz]
Pathway
00010  Glycolysis / Gluconeogenesis
00071  Fatty acid degradation
00350  Tyrosine metabolism
00620  Pyruvate metabolism
00625  Chloroalkane and chloroalkene degradation
00626  Naphthalene degradation
00650  Butanoate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01220  Degradation of aromatic compounds
05146  Amoebiasis
Other DBs
HMP: SRS019024.21176-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_24608:complement(2..160)
AA seq 53 aa
XXXKIGAQFHTIHGRTNAILLPYVIRYNGTRPAKTATWPKYNYYRADEKYQDI

KEGG   T30397 (Metagenome): 24760
Entry
24760             CDS       T30397                                 

Definition
aldehyde-alcohol dehydrogenase 2
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Best hit
cthd:CDO33_01310 (best score: 67.781)
Pathway
00010  Glycolysis / Gluconeogenesis
00071  Fatty acid degradation
00350  Tyrosine metabolism
00620  Pyruvate metabolism
00625  Chloroalkane and chloroalkene degradation
00626  Naphthalene degradation
00650  Butanoate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01220  Degradation of aromatic compounds
05146  Amoebiasis
Other DBs
HMP: SRS019024.24760-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_27114:346..441
AA seq 32 aa
MPSSQGGIGDIYNFKLTPSLTLGCGTWGGNSV

KEGG   T30397 (Metagenome): 23648
Entry
23648             CDS       T30397                                 

Gene name
adh
Definition
aldehyde-alcohol dehydrogenase 2
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Best hit
clo:HMPREF0868_0538 (best score: 90.1225)
Pathway
00010  Glycolysis / Gluconeogenesis
00071  Fatty acid degradation
00350  Tyrosine metabolism
00620  Pyruvate metabolism
00625  Chloroalkane and chloroalkene degradation
00626  Naphthalene degradation
00650  Butanoate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01220  Degradation of aromatic compounds
05146  Amoebiasis
Other DBs
HMP: SRS019024.23648-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_26350:complement(1..174)
AA seq 58 aa
XEFHTVHGRTCGTLLPYVIRYNGTKPEKPGLWPKYQYYNADERYAQLAHAIGLKFNTV

KEGG   T30397 (Metagenome): 11129
Entry
11129             CDS       T30397                                 

Definition
aldehyde-alcohol dehydrogenase 2
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Best hit
got:AXE85_01330 (best score: 66.2402)
Pathway
00010  Glycolysis / Gluconeogenesis
00071  Fatty acid degradation
00350  Tyrosine metabolism
00620  Pyruvate metabolism
00625  Chloroalkane and chloroalkene degradation
00626  Naphthalene degradation
00650  Butanoate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01220  Degradation of aromatic compounds
05146  Amoebiasis
Other DBs
HMP: SRS019024.11129-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_17233:2..136
AA seq 45 aa
MDVLTHATEAYTSNFANDYTDGIALQTIKLVFEWLEKSXXXXXXX

KEGG   T30397 (Metagenome): 24139
Entry
24139             CDS       T30397                                 

Gene name
aad
Definition
aldehyde-alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Best hit
stk:STP_0042 (best score: 279.641)
Taxonomy
Firmicutes - Bacilli [GN:stk]
Pathway
00010  Glycolysis / Gluconeogenesis
00071  Fatty acid degradation
00350  Tyrosine metabolism
00620  Pyruvate metabolism
00625  Chloroalkane and chloroalkene degradation
00626  Naphthalene degradation
00650  Butanoate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01220  Degradation of aromatic compounds
05146  Amoebiasis
Other DBs
HMP: SRS019024.24139-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_26690:3..494
AA seq 164 aa
ARQMVEFNGLGHSAAIHTKDEALAKRFGTEIKAMRIIWNSPSTFGGIGDVYNAFIPSLTL
GCGSYGHNSVGDNVSAINLLNIKKVGKRRNNMQWFKVPSKIYFERNSIQYLQTCEDIERV
MIVTDKSIEKLGFVQRIIDQLNKRSNRVTVQVFSDVEPDPDITT

KEGG   T30397 (Metagenome): 21177
Entry
21177             CDS       T30397                                 

Definition
hypothetical protein
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Best hit
adc:FOC79_09025 chj:NCTC10426_01232 (best score: 41.2022)
Pathway
00010  Glycolysis / Gluconeogenesis
00071  Fatty acid degradation
00350  Tyrosine metabolism
00620  Pyruvate metabolism
00625  Chloroalkane and chloroalkene degradation
00626  Naphthalene degradation
00650  Butanoate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01220  Degradation of aromatic compounds
05146  Amoebiasis
Other DBs
HMP: SRS019024.21177-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_24608:complement(222..308)
AA seq 29 aa
ESSVKNADFHSREKMHNASTIXXXXXXXX

KEGG   T30397 (Metagenome): 17877
Entry
17877             CDS       T30397                                 

Definition
hypothetical protein
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Best hit
stk:STP_0042 (best score: 46.595)
Pathway
00010  Glycolysis / Gluconeogenesis
00071  Fatty acid degradation
00350  Tyrosine metabolism
00620  Pyruvate metabolism
00625  Chloroalkane and chloroalkene degradation
00626  Naphthalene degradation
00650  Butanoate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01220  Degradation of aromatic compounds
05146  Amoebiasis
Other DBs
HMP: SRS019024.17877-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_22227:238..318
AA seq 27 aa
XXXXFNGLGHSAAIHTKDEELAKRFGT

KEGG   T30397 (Metagenome): 14270
Entry
14270             CDS       T30397                                 

Gene name
aad
Definition
aldehyde-alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Best hit
stk:STP_0042 (best score: 99.7525)
Pathway
00010  Glycolysis / Gluconeogenesis
00071  Fatty acid degradation
00350  Tyrosine metabolism
00620  Pyruvate metabolism
00625  Chloroalkane and chloroalkene degradation
00626  Naphthalene degradation
00650  Butanoate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01220  Degradation of aromatic compounds
05146  Amoebiasis
Other DBs
HMP: SRS019024.14270-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_19613:complement(113..340)
AA seq 75 aa
MIVTDQAMVKLGFLQRVIEQLELRPNKVIYEVFSDVEPDPDITTVNRGAEIMKSFEPDTI
VXXXXXXXXXXXQKS

KEGG   T30397 (Metagenome): 28184
Entry
28184             CDS       T30397                                 

Definition
alcohol-acetaldehyde dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Best hit
spz:M5005_Spy0039 (best score: 197.978)
Taxonomy
Firmicutes - Bacilli [GN:spz]
Pathway
00010  Glycolysis / Gluconeogenesis
00071  Fatty acid degradation
00350  Tyrosine metabolism
00620  Pyruvate metabolism
00625  Chloroalkane and chloroalkene degradation
00626  Naphthalene degradation
00650  Butanoate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01220  Degradation of aromatic compounds
05146  Amoebiasis
Other DBs
HMP: SRS019024.28184-T1-C
LinkDB
Position
C905584:complement(3..302)
AA seq 100 aa
GSYGRNSVGDNVSAINLLNIKKVGRRRNNMQWMKLPSKTYFERDSIQYLQKCRDVERVMI
VTDHAMVELGFLDRIIEQLDLRRNKVVYQIFADVEPDPDI

KEGG   T30397 (Metagenome): 14269
Entry
14269             CDS       T30397                                 

Gene name
aad
Definition
aldehyde-alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Best hit
adc:FOC79_09025 chj:NCTC10426_01232 (best score: 77.4109)
Pathway
00010  Glycolysis / Gluconeogenesis
00071  Fatty acid degradation
00350  Tyrosine metabolism
00620  Pyruvate metabolism
00625  Chloroalkane and chloroalkene degradation
00626  Naphthalene degradation
00650  Butanoate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01220  Degradation of aromatic compounds
05146  Amoebiasis
Other DBs
HMP: SRS019024.14269-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_19613:complement(3..116)
AA seq 38 aa
MKSFEPDTIVALGGGSVMDAAKVMWMFYEQPQVDFRDL

KEGG   T30397 (Metagenome): 17876
Entry
17876             CDS       T30397                                 

Definition
aldehyde-alcohol dehydrogenase 2
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Best hit
gan:UMN179_01404 (best score: 76.2553)
Pathway
00010  Glycolysis / Gluconeogenesis
00071  Fatty acid degradation
00350  Tyrosine metabolism
00620  Pyruvate metabolism
00625  Chloroalkane and chloroalkene degradation
00626  Naphthalene degradation
00650  Butanoate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01220  Degradation of aromatic compounds
05146  Amoebiasis
Other DBs
HMP: SRS019024.17876-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_22227:2..154
AA seq 51 aa
EQAGFKVPAETNILAAECAEVGENEPLTREKLSPVIAVLKAEDTEXXXXXX

DBGET integrated database retrieval system