KEGG   T30397 (Metagenome): 17205
Entry
17205             CDS       T30397                                 

Definition
pyruvate synthase
  KO
K00174  2-oxoglutarate/2-oxoacid ferredoxin oxidoreductase subunit alpha [EC:1.2.7.3 1.2.7.11]
Best hit
pru:PRU_2267 (best score: 73.559)
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.17205-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_21741:3..155
AA seq 51 aa
EEQIEVKELDSVVVHFSGDSGDGMQLAGNIFTTVSASVGNGVSTXXXXXXX

KEGG   T30397 (Metagenome): 1764
Entry
1764              CDS       T30397                                 

Definition
pyruvate synthase
  KO
K00174  2-oxoglutarate/2-oxoacid ferredoxin oxidoreductase subunit alpha [EC:1.2.7.3 1.2.7.11]
Best hit
bth:BT_2836 (best score: 66.2402)
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.1764-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_4879:196..351
AA seq 52 aa
MGVTTVQCEDEIAGCASAIGAAFAGALAATSTSGPGICLKSEAMNLALIDEL

KEGG   T30397 (Metagenome): 17206
Entry
17206             CDS       T30397                                 

Definition
pyruvate synthase
  KO
K00174  2-oxoglutarate/2-oxoacid ferredoxin oxidoreductase subunit alpha [EC:1.2.7.3 1.2.7.11]
Best hit
pru:PRU_2267 (best score: 97.8265)
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.17206-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_21741:202..348
AA seq 49 aa
XDYPADIRAPQGSLTGVSGFQVHIGAGKVYTPGDRCDVLVAMNAAALKM

KEGG   T30397 (Metagenome): 31766
Entry
31766             CDS       T30397                                 

Definition
hypothetical protein
  KO
K00174  2-oxoglutarate/2-oxoacid ferredoxin oxidoreductase subunit alpha [EC:1.2.7.3 1.2.7.11]
Best hit
vpr:Vpar_1461 (best score: 264.618)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.31766-T1-C
LinkDB
Position
C917263:155..559
AA seq 135 aa
VNLLQKRKDFIWKMGGQQGEGIESCGEIMATILAKEGYSLYSQRLFASRIKGGHTTFALR
VALEQIMSIGEGVDFLLSLDQETVDMHGSEVRDGGYIICDSKVNPDFSKFEGTKINCLSL
PISETAMKQGSLLMR

KEGG   T30397 (Metagenome): 26684
Entry
26684             CDS       T30397                                 

Definition
pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K00174  2-oxoglutarate/2-oxoacid ferredoxin oxidoreductase subunit alpha [EC:1.2.7.3 1.2.7.11]
Best hit
vpr:Vpar_1461 (best score: 374.4)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.26684-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_28419:complement(339..896)
AA seq 185 aa
PELVQPNYFKRFELTEDGISPRTIPGMKNGLFLSTGLEHNEEGKPAEAPTMHVAQTDKRF
RKLETVADNYEPFLNNAKYDEADVLVVGMASSRGAIEEAVAEFDQEGVKVNHLQLRLIKP
FPAKQLQPFFDAAKKVVIVEHNKTGQLANLFKINMHKKHKISSCLKYDGNPFTKSYVKNA
IKEVL

KEGG   T30397 (Metagenome): 15255
Entry
15255             CDS       T30397                                 

Definition
2-oxoglutarate ferredoxin oxidoreductase subunit beta
  KO
K00175  2-oxoglutarate/2-oxoacid ferredoxin oxidoreductase subunit beta [EC:1.2.7.3 1.2.7.11]
Best hit
got:AXE85_06245 (best score: 96.6709)
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.15255-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_20317:196..333
AA seq 46 aa
XNDVKPDWCAGCGDFSVLAGINRAVVNLGIKPENVVISAGIGCSGK

KEGG   T30397 (Metagenome): 26683
Entry
26683             CDS       T30397                                 

Definition
2-oxoglutarate ferredoxin oxidoreductase subunit beta
  KO
K00175  2-oxoglutarate/2-oxoacid ferredoxin oxidoreductase subunit beta [EC:1.2.7.3 1.2.7.11]
Best hit
vpr:Vpar_1460 (best score: 232.646)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.26683-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_28419:complement(2..337)
AA seq 112 aa
MTTAKDYRNDIRPNWCPGCGHYGVQAAITDAVVAKNIPPEKLAVISGIGCSSRIGGYFYA
YGAHTTHGRALPYAQGVKLANQDLEVIAFSGDGDAFAIGMGHTIHAFKRNVN

KEGG   T30397 (Metagenome): 22878
Entry
22878             CDS       T30397                                 

Gene name
orB
Definition
alpha oxoglutarate ferredoxin oxidoreductase, beta subunit
  KO
K00175  2-oxoglutarate/2-oxoacid ferredoxin oxidoreductase subunit beta [EC:1.2.7.3 1.2.7.11]
Best hit
pgi:PG_0430 (best score: 82.0333)
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.22878-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_25801:complement(2..175)
AA seq 58 aa
XXXXGAAVTEVLVNCVIFNDGAHKYLSSKEVRAEKTIVLEHGKKMIFGQNLDKGLVLD

KEGG   T30397 (Metagenome): 28513
Entry
28513             CDS       T30397                                 

Definition
2-oxoglutarate ferredoxin oxidoreductase subunit beta
  KO
K00175  2-oxoglutarate/2-oxoacid ferredoxin oxidoreductase subunit beta [EC:1.2.7.3 1.2.7.11]
Best hit
vpr:Vpar_1460 (best score: 209.149)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.28513-T1-C
LinkDB
Position
C906738:complement(2..310)
AA seq 103 aa
QGVKLANQDLEVIAFSGDGDAFAIGMGHTIHAFKRNVNMTYVVMDNHVYGLTKGQASPRS
DIGFVTKTTPHGAFESPLSVCETAIAAGATFVAQSYMVNRKEL

KEGG   T30397 (Metagenome): 654
Entry
654               CDS       T30397                                 

Definition
2-oxoglutarate ferredoxin oxidoreductase subunit beta
  KO
K00175  2-oxoglutarate/2-oxoacid ferredoxin oxidoreductase subunit beta [EC:1.2.7.3 1.2.7.11]
Best hit
pru:PRU_2268 (best score: 59.3066)
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.654-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_1855:complement(3..107)
AA seq 35 aa
XXXGITRDDILVHDAHCQDNTLQLKLAMMSNEDGF

KEGG   T30397 (Metagenome): 655
Entry
655               CDS       T30397                                 

Definition
putative oxidoreductase
  KO
K00175  2-oxoglutarate/2-oxoacid ferredoxin oxidoreductase subunit beta [EC:1.2.7.3 1.2.7.11]
Best hit
pru:PRU_2268 (best score: 53.5286)
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.655-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_1855:complement(195..308)
AA seq 38 aa
GRKENAIYVKHGEPLIFGPNQEFGLVQEGFXXXXXXXX

DBGET integrated database retrieval system