KEGG   T30397 (Metagenome): 17710
Entry
17710             CDS       T30397                                 

Definition
hypothetical protein
  KO
K00748  lipid-A-disaccharide synthase [EC:2.4.1.182]
Best hit
asx:CDL62_01560 (best score: 50.0618)
Pathway
00540  Lipopolysaccharide biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS019024.17710-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_22106:1..153
AA seq 51 aa
VVIAGAPGLTAADYAPHLGKYSDTPILFGDTYGLMRRAHAALVTSXXXXXX

KEGG   T30397 (Metagenome): 17711
Entry
17711             CDS       T30397                                 

Definition
hypothetical protein
  KO
K00748  lipid-A-disaccharide synthase [EC:2.4.1.182]
Best hit
fae:FAES_2767 (best score: 37.7354)
Pathway
00540  Lipopolysaccharide biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS019024.17711-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_22106:207..347
AA seq 47 aa
XXXARLTFERLFRVPYFSLVNLILDRPAVPELLADRAHSVQILSILS

KEGG   T30397 (Metagenome): 26598
Entry
26598             CDS       T30397                                 

Gene name
lpxB
Definition
lipid-A-disaccharide synthetase
  KO
K00748  lipid-A-disaccharide synthase [EC:2.4.1.182]
Best hit
aap:NT05HA_1548 (best score: 276.174)
Taxonomy
Gammaproteobacteria - Others [GN:aap]
Pathway
00540  Lipopolysaccharide biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS019024.26598-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_28358:2..595
AA seq 198 aa
SFFDMEELSVMGLVEVLKHLPRLLKIRRSIIDQLSDIKPDVFIGIDAPDFNLTVELKLKE
KGIKTIHYVSPSVWAWXXXXXXXXXXXXXXXXPSVWAWRQNRIYKIAKATHQVLAFLPFE
KAFYDRFNVPCRFIGHTMADAIPLKPNRTEACQTLGIDEKGRYLAILVGSRGSEVGFLTE
PFLKTALLLKEXXXXXXX

KEGG   T30397 (Metagenome): 3412
Entry
3412              CDS       T30397                                 

Gene name
lpxB
Definition
lipid-A-disaccharide synthetase
  KO
K00748  lipid-A-disaccharide synthase [EC:2.4.1.182]
Best hit
aap:NT05HA_1548 (best score: 54.299)
Pathway
00540  Lipopolysaccharide biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS019024.3412-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_8765:complement(3..107)
AA seq 35 aa
XXXILGAGLIKALKRHYPQAKFVGIGGERMIDQGF

KEGG   T30397 (Metagenome): 8830
Entry
8830              CDS       T30397                                 

Gene name
lpxB
Definition
lipid-A-disaccharide synthetase
  KO
K00748  lipid-A-disaccharide synthase [EC:2.4.1.182]
Best hit
vpr:Vpar_0538 (best score: 75.0997)
Pathway
00540  Lipopolysaccharide biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS019024.8830-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_15459:3..125
AA seq 41 aa
YIAPTIWAWHSSRGNTIRKYVTKVASIFPFEAEAYXXXXXX

KEGG   T30397 (Metagenome): 8831
Entry
8831              CDS       T30397                                 

Gene name
lpxB
Definition
lipid-A-disaccharide synthetase
  KO
K00748  lipid-A-disaccharide synthase [EC:2.4.1.182]
Best hit
vpr:Vpar_0538 (best score: 162.925)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00540  Lipopolysaccharide biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS019024.8831-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_15459:177..446
AA seq 90 aa
XXXLDIVHPTMTKQEAEEYFGARKEAKKVLLMPGSRKQEVLSLLDTMLKSGEQLIAKHDD
IQFFLPRAHTIDRSELEAFINSHKVPVTIT

DBGET integrated database retrieval system