KEGG   T30397 (Metagenome): 19319
Entry
19319             CDS       T30397                                 

Definition
transketolase domain protein
  KO
K00615  transketolase [EC:2.2.1.1]
Best hit
vpr:Vpar_0805 (best score: 221.476)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00030  Pentose phosphate pathway
00710  Carbon fixation in photosynthetic organisms
01051  Biosynthesis of ansamycins
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.19319-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_23272:3..329
AA seq 109 aa
EKAKAIRVGIVQSVTAAKSGHPGGSLSIADVMALLYYVEMNVDPANPKAPNRDRFVLSKG
HAAPALYATLAEKGYFPKEELLNLRKINHMLQGHPDMKHTPGVDMSTGS

KEGG   T30397 (Metagenome): 33164
Entry
33164             CDS       T30397                                 

Gene name
tktN
Definition
transketolase n-terminal section
  KO
K00615  transketolase [EC:2.2.1.1]
Best hit
bths:CNY62_11060 (best score: 332.413)
Taxonomy
Firmicutes - Bacilli [GN:bths]
Pathway
00030  Pentose phosphate pathway
00710  Carbon fixation in photosynthetic organisms
01051  Biosynthesis of ansamycins
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.33164-T1-C
LinkDB
Position
C920176:complement(631..1488)
AA seq 285 aa
MILSENREDELRKFATKIRLNTLRTLNHLGFGHYGGSLSIVEVLAVLYGEIMPMTPEIFA
SRDRDYFVLSKGHAGPALYSTLYLNGFFDKEFLHSLNTNGTKLPSHPDRNLTPGIDMTTG
SLGQGISVATGLAYGQRIRKSPFYTYAIVGDGELNEGQCWEAIQFASHQQLSNLIVFVDD
NKKQLDGFTKDICNPGDFVEKFSAFGFESIRVNGSDIREIYEGIIQLKQSNNSSPKCIVL
DTIKGQGVRELEEMKSNHHLRPTVEERQMLTSVVERLSQELEETE

KEGG   T30397 (Metagenome): 17479
Entry
17479             CDS       T30397                                 

Definition
transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Best hit
marr:BKP56_08785 (best score: 78.5666)
Pathway
00030  Pentose phosphate pathway
00710  Carbon fixation in photosynthetic organisms
01051  Biosynthesis of ansamycins
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.17479-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_21942:2..160
AA seq 53 aa
GYIGTFFVFADYVKPAMRVAALSKLPTIYVYTHDSIAVGEDGPTHXXXXXXXX

KEGG   T30397 (Metagenome): 19320
Entry
19320             CDS       T30397                                 

Definition
hypothetical protein
  KO
K00615  transketolase [EC:2.2.1.1]
Best hit
vpr:Vpar_0805 (best score: 92.0485)
Pathway
00030  Pentose phosphate pathway
00710  Carbon fixation in photosynthetic organisms
01051  Biosynthesis of ansamycins
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.19320-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_23273:complement(2..151)
AA seq 50 aa
XXXEKAKAIRVSIVQSVTAAKSGHPGGSLSIADVMALLYYVEMNVDPANP

KEGG   T30397 (Metagenome): 18842
Entry
18842             CDS       T30397                                 

Gene name
tkt
Definition
transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Best hit
kpul:GXN76_11910 (best score: 82.4185)
Pathway
00030  Pentose phosphate pathway
00710  Carbon fixation in photosynthetic organisms
01051  Biosynthesis of ansamycins
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.18842-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_22900:complement(2..145)
AA seq 48 aa
XMAEAHLAAKFNREGYPVVDHHTYVLCGDGDLMEGISYEAASLAGTLK

KEGG   T30397 (Metagenome): 11706
Entry
11706             CDS       T30397                                 

Definition
transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Best hit
mbf:BHV42_00195 (best score: 61.6178)
Pathway
00030  Pentose phosphate pathway
00710  Carbon fixation in photosynthetic organisms
01051  Biosynthesis of ansamycins
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.11706-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_17689:complement(170..355)
AA seq 62 aa
GTPILTVENHNEIGGIGSALCELFATDNTTDVHRLGVHEKFGQVGKVPYLLAQYXXXXXX
XX

KEGG   T30397 (Metagenome): 4901
Entry
4901              CDS       T30397                                 

Definition
endo-alpha-N-acetylgalactosaminidase
  KO
K00615  transketolase [EC:2.2.1.1]
Best hit
gha:NCTC10459_01534 (best score: 35.8094)
Pathway
00030  Pentose phosphate pathway
00710  Carbon fixation in photosynthetic organisms
01051  Biosynthesis of ansamycins
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.4901-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_11685:complement(1..111)
AA seq 37 aa
XXXXVNAVQALVHELPEFVGGVNAVQALVHELPEFVG

KEGG   T30397 (Metagenome): 17480
Entry
17480             CDS       T30397                                 

Gene name
tkt
Definition
transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Best hit
spy:SPy_1676 (best score: 79.3369)
Pathway
00030  Pentose phosphate pathway
00710  Carbon fixation in photosynthetic organisms
01051  Biosynthesis of ansamycins
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.17480-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_21942:214..384
AA seq 57 aa
XXXNVFRPADGNEVAAAWKTALEETTRPSLLVLSRQNLPVLEHSLELAFDGVDKGAY

KEGG   T30397 (Metagenome): 21129
Entry
21129             CDS       T30397                                 

Definition
probable transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Best hit
bths:CNY62_12740 got:AXE85_05400 (best score: 82.4185)
Pathway
00030  Pentose phosphate pathway
00710  Carbon fixation in photosynthetic organisms
01051  Biosynthesis of ansamycins
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.21129-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_24575:226..414
AA seq 62 aa
XXXXRRRVAVEMGATQNWYKYVGLDGAVLGIDTFGASAPAPKVLAEYGFTVENLVKVVQN
LK

KEGG   T30397 (Metagenome): 13429
Entry
13429             CDS       T30397                                 

Definition
transketolase domain protein
  KO
K00615  transketolase [EC:2.2.1.1]
Best hit
vpr:Vpar_0805 (best score: 189.889)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00030  Pentose phosphate pathway
00710  Carbon fixation in photosynthetic organisms
01051  Biosynthesis of ansamycins
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.13429-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_18989:complement(23..298)
AA seq 91 aa
XDITKVLSPLPIPEKFKAFNWNVIEVNGHDLDELHNAIETAKAFTEGPTCIIMHTVKGKG
VEEMEGQAGWHGKAPSEEQGVAFVNEIMGVQ

KEGG   T30397 (Metagenome): 21128
Entry
21128             CDS       T30397                                 

Definition
transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Best hit
str:Sterm_3765 str:Sterm_1547 (best score: 66.6254)
Pathway
00030  Pentose phosphate pathway
00710  Carbon fixation in photosynthetic organisms
01051  Biosynthesis of ansamycins
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.21128-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_24575:3..173
AA seq 57 aa
ADARETQAAWYLAVTSEKTPTALVLTRQNLTVEEGTDFDKVAKGAYVVYEXXXXXXX

KEGG   T30397 (Metagenome): 11040
Entry
11040             CDS       T30397                                 

Definition
hypothetical protein
  KO
K00615  transketolase [EC:2.2.1.1]
Best hit
bacc:BRDCF_p75 (best score: 40.817)
Pathway
00030  Pentose phosphate pathway
00710  Carbon fixation in photosynthetic organisms
01051  Biosynthesis of ansamycins
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.11040-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_17165:complement(231..308)
AA seq 25 aa
HWHGKSPNADQANQALSQLSEGSGE

KEGG   T30397 (Metagenome): 10777
Entry
10777             CDS       T30397                                 

Gene name
tktA
Definition
transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Best hit
cro:ROD_50601 son:SO_0930 (best score: 82.4185)
Pathway
00030  Pentose phosphate pathway
00710  Carbon fixation in photosynthetic organisms
01051  Biosynthesis of ansamycins
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.10777-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_16968:complement(3..122)
AA seq 40 aa
XXXFLKHNPNNPKWADRDRFVLSNGHGSMLIYSLLHLTGY

KEGG   T30397 (Metagenome): 8255
Entry
8255              CDS       T30397                                 

Gene name
tkt
Definition
transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Best hit
rmu:RMDY18_10930 (best score: 67.3958)
Pathway
00030  Pentose phosphate pathway
00710  Carbon fixation in photosynthetic organisms
01051  Biosynthesis of ansamycins
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.8255-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_15034:complement(2..115)
AA seq 38 aa
XXXGSKLGAEEVAATKEVLGFDPAKSFFIEENVLEHTR

KEGG   T30397 (Metagenome): 18843
Entry
18843             CDS       T30397                                 

Gene name
tkt
Definition
transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Best hit
jep:BW721_07150 (best score: 83.1889)
Pathway
00030  Pentose phosphate pathway
00710  Carbon fixation in photosynthetic organisms
01051  Biosynthesis of ansamycins
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.18843-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_22900:complement(179..331)
AA seq 51 aa
LWSKYLKVNPKRSTWVDRDRFVLSAGHGSAMLYALLHLSGYDLXXXXXXXX

KEGG   T30397 (Metagenome): 33163
Entry
33163             CDS       T30397                                 

Gene name
tktC
Definition
transketolase c-terminal section
  KO
K00615  transketolase [EC:2.2.1.1]
Best hit
bths:CNY62_11065 (best score: 229.18)
Taxonomy
Firmicutes - Bacilli [GN:bths]
Pathway
00030  Pentose phosphate pathway
00710  Carbon fixation in photosynthetic organisms
01051  Biosynthesis of ansamycins
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.33163-T1-C
LinkDB
Position
C920176:complement(2..634)
AA seq 211 aa
MMRSTKELRHVYRDFLLEANQSYSDIVVLEADLSSSMATNNLEKDFGDRYVNVGIMEAEM
VGLAAGLSIQGFRPYLHTFGPFASRRVFDQLFISLGYAQLDATVIGSDAGVTAEMNGGTH
MPFEEIGLLRLIPKSIIFEATDDIQFREILNQTLELKGLKYIRTIRKAPEAVYQGGEDFS
KGYIELRHGEDVVIVASGIMVAPSIRVADEL

KEGG   T30397 (Metagenome): 31885
Entry
31885             CDS       T30397                                 

Definition
transketolase, pyridine binding domain protein
  KO
K00615  transketolase [EC:2.2.1.1]
Best hit
vpr:Vpar_0806 (best score: 382.104)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00030  Pentose phosphate pathway
00710  Carbon fixation in photosynthetic organisms
01051  Biosynthesis of ansamycins
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.31885-T1-C
LinkDB
Position
C917557:complement(2..580)
AA seq 193 aa
MGKATREAYGNALARIGKENTNIIVLDADLSKSTKTDTFKAVCPERFFNVGIAEQNLISV
GAGLAAAGKIPFVSSFSMFATGRAFEQIRNAVCYPKLNVKVCATHAGITVGEDGATHQSL
EDISCMRTLPNMTVVVPADERETEAVIEWAASYNGPVYVRLGRAGVDDVTTEGYSFVPGK
STILVDGSDVTII

KEGG   T30397 (Metagenome): 11039
Entry
11039             CDS       T30397                                 

Definition
transketolase, central region
  KO
K00615  transketolase [EC:2.2.1.1]
Best hit
sox:TM7x_02430 (best score: 75.8701)
Pathway
00030  Pentose phosphate pathway
00710  Carbon fixation in photosynthetic organisms
01051  Biosynthesis of ansamycins
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.11039-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_17165:complement(2..118)
AA seq 39 aa
XAIEVGVAEQNLVTVASGLAAMGNIPFAASYAAFSPGRN

KEGG   T30397 (Metagenome): 13430
Entry
13430             CDS       T30397                                 

Definition
transketolase, thiamine diphosphate binding domain protein
  KO
K00615  transketolase [EC:2.2.1.1]
Best hit
vpr:Vpar_0805 (best score: 147.902)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00030  Pentose phosphate pathway
00710  Carbon fixation in photosynthetic organisms
01051  Biosynthesis of ansamycins
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.13430-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_18989:complement(344..586)
AA seq 81 aa
VDMSTGSLGQGISAACGMALAGKIDNADYRVYSILGDGELEEGQVWEAAMFAGFYKLNNL
TAFVDFNGLQIDGXXXXXXXX

KEGG   T30397 (Metagenome): 8256
Entry
8256              CDS       T30397                                 

Gene name
tkt
Definition
transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Best hit
rmu:RMDY18_10930 (best score: 165.236)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00030  Pentose phosphate pathway
00710  Carbon fixation in photosynthetic organisms
01051  Biosynthesis of ansamycins
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.8256-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_15034:complement(173..430)
AA seq 86 aa
GNLIVVWDRNHISIEEDTDVAFTEDVAKRYESYGWDVQRVDWTRTGEYVEDVAELYAAIE
RAKAVTDKPSFIELRTIIGYXXXXXX

KEGG   T30397 (Metagenome): 28771
Entry
28771             CDS       T30397                                 

Definition
transketolase, pyridine binding domain protein
  KO
K00615  transketolase [EC:2.2.1.1]
Best hit
vpr:Vpar_0806 (best score: 191.045)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00030  Pentose phosphate pathway
00710  Carbon fixation in photosynthetic organisms
01051  Biosynthesis of ansamycins
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.28771-T1-C
LinkDB
Position
C907636:3..320
AA seq 106 aa
VTIIACGALVGPAVEASKTLSESNISARVINMASIKPIDAEAIIKAAAETGAIVTAEEHN
IIGGLGSAVSEVVVSNKPVPMEFVGVQDTFGESGTPKELMAKYGLT

DBGET integrated database retrieval system