KEGG   T30397 (Metagenome): 19521
Entry
19521             CDS       T30397                                 

Definition
hypothetical protein
  KO
K01649  2-isopropylmalate synthase [EC:2.3.3.13]
Best hit
tht:E2K93_08685 (best score: 28.8758)
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.19521-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_23429:complement(3..152)
AA seq 50 aa
XXXYTKELTLGERIDLYKETLNDGEQCDVTETFLNYIGIPKYKLSCMLNI

KEGG   T30397 (Metagenome): 17734
Entry
17734             CDS       T30397                                 

Definition
leuA allosteric (dimerisation) domain
  KO
K01649  2-isopropylmalate synthase [EC:2.3.3.13]
Best hit
amy:ADJ76_04795 (best score: 43.8986)
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.17734-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_22127:complement(216..311)
AA seq 32 aa
GVGIDSSITRASYKAVISAVNRALXXXXXXXX

KEGG   T30397 (Metagenome): 15391
Entry
15391             CDS       T30397                                 

Gene name
leuA1
Definition
2-isopropylmalate synthase 1
  KO
K01649  2-isopropylmalate synthase [EC:2.3.3.13]
Best hit
vpr:Vpar_0094 (best score: 88.1965)
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.15391-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_20421:223..363
AA seq 47 aa
XXXLHMEYKLKMTRQEVLDKVKSVLAYAKGKVDEIEFSGEDAARSDL

KEGG   T30397 (Metagenome): 28285
Entry
28285             CDS       T30397                                 

Gene name
leuA
Definition
2-isopropylmalate synthase
  KO
K01649  2-isopropylmalate synthase [EC:2.3.3.13]
Best hit
vpr:Vpar_0094 (best score: 206.453)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.28285-T1-C
LinkDB
Position
C905940:1..303
AA seq 101 aa
GSNAFAHESGIHQHGMMSNPETYEIMTPESVGAEKTDLVLGKHSGRHAFADHLAKLGFQS
FTEEKINDLFGKFKELADRKKQVYDDDIVALVVDNLHHKKA

KEGG   T30397 (Metagenome): 15390
Entry
15390             CDS       T30397                                 

Gene name
leuA
Definition
2-isopropylmalate synthase
  KO
K01649  2-isopropylmalate synthase [EC:2.3.3.13]
Best hit
vpr:Vpar_0094 (best score: 82.4185)
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.15390-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_20421:3..149
AA seq 49 aa
GLVRLGIDVIEAGFPAASPGDFEAVQTIAREVKGATICALARXXXXXXX

KEGG   T30397 (Metagenome): 28518
Entry
28518             CDS       T30397                                 

Gene name
leuA
Definition
2-isopropylmalate synthase
  KO
K01649  2-isopropylmalate synthase [EC:2.3.3.13]
Best hit
llk:LLKF_1260 (best score: 155.606)
Taxonomy
Firmicutes - Bacilli [GN:llk]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.28518-T1-C
LinkDB
Position
C906752:2..310
AA seq 103 aa
EALKDAKYPQIHVFIATSPIHREFKLNKTKEEILETIKEHVSYARSKFEIVEFSPEDATR
TELDFLLQVVQTAVDAGASYINIPDTVGFTTPAEYGAIFKYLI

KEGG   T30397 (Metagenome): 21694
Entry
21694             CDS       T30397                                 

Gene name
leuA
Definition
2-isopropylmalate synthase
  KO
K01649  2-isopropylmalate synthase [EC:2.3.3.13]
Best hit
vpr:Vpar_0094 (best score: 101.293)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.21694-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_24975:3..176
AA seq 58 aa
EKTDLVLGKHSGRHAFADHLAKLGFQSFAEEKINDLFAKFKELADRKKQVYXXXXXXX

KEGG   T30397 (Metagenome): 24212
Entry
24212             CDS       T30397                                 

Gene name
leuA
Definition
2-isopropylmalate synthase
  KO
K01649  2-isopropylmalate synthase [EC:2.3.3.13]
Best hit
mht:D648_8420 (best score: 93.2041)
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.24212-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_26740:complement(325..528)
AA seq 68 aa
SRVAALSRAVIKDIDAAAEALKVAEAFRIHTFIAVSALHVEAKLKRTFDDVVEMAVAAVK
HXXXXXXX

KEGG   T30397 (Metagenome): 24211
Entry
24211             CDS       T30397                                 

Gene name
leuA
Definition
2-isopropylmalate synthase
  KO
K01649  2-isopropylmalate synthase [EC:2.3.3.13]
Best hit
mht:D648_8420 hin:HI0986 (best score: 101.293)
Taxonomy
Gammaproteobacteria - Others [GN:mht]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.24211-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_26740:complement(117..302)
AA seq 62 aa
XXXXDVEFSCEDAGRTGIDNICRIVEAAINAGATTVNIPDTVGFCLPNQFGNIIXXXXXX
XX

KEGG   T30397 (Metagenome): 23678
Entry
23678             CDS       T30397                                 

Gene name
leuA
Definition
2-isopropylmalate synthase
  KO
K01649  2-isopropylmalate synthase [EC:2.3.3.13]
Best hit
rmu:RMDY18_10260 (best score: 113.62)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.23678-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_26371:3..191
AA seq 63 aa
DKVMEKAPRWCAVDLRDGNQALIDPMDTDRKLAMFKLLVKMGYKEIEVGFPSASQTXXXX
XXX

KEGG   T30397 (Metagenome): 11996
Entry
11996             CDS       T30397                                 

Gene name
leuA
Definition
2-isopropylmalate synthase
  KO
K01649  2-isopropylmalate synthase [EC:2.3.3.13]
Best hit
fhw:RN87_01995 (best score: 77.7962)
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.11996-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_17912:1..138
AA seq 46 aa
AIVGANAFSHESGIHQHGVLANPETYEIIKPEVVGRNVDXXXXXXX

KEGG   T30397 (Metagenome): 29048
Entry
29048             CDS       T30397                                 

Gene name
leuA
Definition
2-isopropylmalate synthase
  KO
K01649  2-isopropylmalate synthase [EC:2.3.3.13]
Best hit
spw:SPCG_1044 (best score: 192.586)
Taxonomy
Firmicutes - Bacilli [GN:spw]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.29048-T1-C
LinkDB
Position
C908644:3..329
AA seq 109 aa
YINIPDTVGFTTPEEYGAIFKYLIENVKTERQIIYSPHCHDDLGMAVANSLVAVKNGAGR
VEGTINGIGERAGNAALEEIAVALNIRQDYYQAETSIVLNETINTSEMV

KEGG   T30397 (Metagenome): 21695
Entry
21695             CDS       T30397                                 

Gene name
leuA
Definition
2-isopropylmalate synthase
  KO
K01649  2-isopropylmalate synthase [EC:2.3.3.13]
Best hit
vpr:Vpar_0094 (best score: 143.28)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.21695-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_24975:327..548
AA seq 73 aa
VVGLPISLKDYQIRAITAGKDALGEATLKVEYNGRLYHGRGISTDIVKSSVNAYINAVNS
VFLAMELEQQEEE

KEGG   T30397 (Metagenome): 17836
Entry
17836             CDS       T30397                                 

Gene name
leuA
Definition
2-isopropylmalate synthase
  KO
K01649  2-isopropylmalate synthase [EC:2.3.3.13]
Best hit
vpr:Vpar_0094 (best score: 206.453)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.17836-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_22201:complement(2..313)
AA seq 104 aa
KVKSVLAYAKGKVDEIEFSGEDAARADLDFACQVFGVAIAGGATIINVPDTVGYMNPNEF
GDKIRYIKEHTSGIENAIISVHCHDDLGLANANTLAAIKAGARQ

KEGG   T30397 (Metagenome): 23679
Entry
23679             CDS       T30397                                 

Gene name
leuA
Definition
2-isopropylmalate synthase
  KO
K01649  2-isopropylmalate synthase [EC:2.3.3.13]
Best hit
rmu:RMDY18_10260 (best score: 303.138)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.23679-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_26371:214..687
AA seq 158 aa
XXXVLVQAREHLIARTFEAIEGAPQAIVHFYNSTSVLQRRVVFHQDQEGVLDIALQGARL
CRKYEEQMISDTKIIYEYSPESFTGTELEYAARVVNAVADELEIGQNGRELIVNLPATVE
MATPNVYADSVEWMDRNLNHREHIVLSLHPHNDRGTGV

KEGG   T30397 (Metagenome): 24210
Entry
24210             CDS       T30397                                 

Gene name
leuA
Definition
2-isopropylmalate synthase
  KO
K01649  2-isopropylmalate synthase [EC:2.3.3.13]
Best hit
aap:NT05HA_1564 apag:EIA51_09320 (best score: 58.5362)
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.24210-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_26740:complement(3..98)
AA seq 32 aa
XXXGERAGNTALEEVVMAIKTRQALFGVDTRI

DBGET integrated database retrieval system