KEGG   T30397 (Metagenome): 1963
Entry
1963              CDS       T30397                                 

Gene name
glk
Definition
glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Best hit
adc:FOC79_00055 (best score: 55.8398)
Pathway
00010  Glycolysis / Gluconeogenesis
00052  Galactose metabolism
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
00521  Streptomycin biosynthesis
00524  Neomycin, kanamycin and gentamicin biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.1963-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_5389:complement(379..501)
AA seq 41 aa
DRPFACTCGKKGCLETVASATGIVNLARRYADEXXXXXXXX

KEGG   T30397 (Metagenome): 5634
Entry
5634              CDS       T30397                                 

Definition
glucokinase, ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Best hit
bfa:Bfae_14240 (best score: 46.595)
Pathway
00010  Glycolysis / Gluconeogenesis
00052  Galactose metabolism
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
00521  Streptomycin biosynthesis
00524  Neomycin, kanamycin and gentamicin biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.5634-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_12805:1..117
AA seq 39 aa
VIAGGLAEAGEILLAPTRKAFADNLTAGTHRPTXXXXXX

KEGG   T30397 (Metagenome): 1962
Entry
1962              CDS       T30397                                 

Gene name
glk
Definition
glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Best hit
ppe:PEPE_0732 (best score: 50.447)
Pathway
00010  Glycolysis / Gluconeogenesis
00052  Galactose metabolism
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
00521  Streptomycin biosynthesis
00524  Neomycin, kanamycin and gentamicin biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.1962-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_5389:complement(200..328)
AA seq 43 aa
XXXANMLNPSFIVIGGGVSAAGEFLLEGVRKEYEQLVXXXXXX

KEGG   T30397 (Metagenome): 6155
Entry
6155              CDS       T30397                                 

Definition
hypothetical protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Best hit
got:AXE85_00565 (best score: 43.8986)
Pathway
00010  Glycolysis / Gluconeogenesis
00052  Galactose metabolism
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
00521  Streptomycin biosynthesis
00524  Neomycin, kanamycin and gentamicin biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.6155-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_13232:200..301
AA seq 34 aa
XXXXLESRYNMYLGIDIGGTSIKFAVFDDNYKII

KEGG   T30397 (Metagenome): 8844
Entry
8844              CDS       T30397                                 

Definition
glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Best hit
jep:BW721_04020 (best score: 55.0694)
Pathway
00010  Glycolysis / Gluconeogenesis
00052  Galactose metabolism
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
00521  Streptomycin biosynthesis
00524  Neomycin, kanamycin and gentamicin biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.8844-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_15470:199..327
AA seq 43 aa
XXXAGDFLLQGVQKVYDENTFPQVRTTTKLALATLGNDAGVIG

KEGG   T30397 (Metagenome): 17719
Entry
17719             CDS       T30397                                 

Definition
glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Best hit
pru:PRU_0241 (best score: 115.546)
Taxonomy
Bacteroidetes [GN:pru]
Pathway
00010  Glycolysis / Gluconeogenesis
00052  Galactose metabolism
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
00521  Streptomycin biosynthesis
00524  Neomycin, kanamycin and gentamicin biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.17719-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_22114:187..438
AA seq 84 aa
XXXXLDLGGTNAVFGVVDQRGQVLATNSIKTQAYKTVDDFVEAGVEAIRPLVAKYGGIGQ
FRAMGIGAPNGNFYRGTIEFAPNL

KEGG   T30397 (Metagenome): 20041
Entry
20041             CDS       T30397                                 

Gene name
glcK
Definition
glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Best hit
bmur:ABE28_013600 (best score: 72.7886)
Pathway
00010  Glycolysis / Gluconeogenesis
00052  Galactose metabolism
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
00521  Streptomycin biosynthesis
00524  Neomycin, kanamycin and gentamicin biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.20041-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_23815:91..330
AA seq 80 aa
MNGGILMKVAVGIDIGGTKXXXXXXXXXNDNDLRIQDTYGIGVGLPGKVDVENGVAIFQN
NIPWANFPIVERLKETYGDI

DBGET integrated database retrieval system