KEGG   T30397 (Metagenome): 20455
Entry
20455             CDS       T30397                                 

Definition
beta-ala-xaa dipeptidase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Best hit
got:AXE85_03685 (best score: 96.2857)
Pathway
00300  Lysine biosynthesis
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.20455-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_24106:complement(210..413)
AA seq 68 aa
FEKFLANEKLEGKVEVGNTIKLVLKGKAAHGSTPQFGINGATKLAEFLSTLGLDVNGKNF
VNXXXXXX

KEGG   T30397 (Metagenome): 22750
Entry
22750             CDS       T30397                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Best hit
rmu:RMDY18_06070 (best score: 90.8929)
Pathway
00300  Lysine biosynthesis
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.22750-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_25711:259..402
AA seq 48 aa
XERTRIILAGHLDTVPLPTVEGSLGTVPATVREEDGEYVLYGRGATDM

KEGG   T30397 (Metagenome): 25631
Entry
25631             CDS       T30397                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Best hit
rmu:RMDY18_06070 (best score: 100.523)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00300  Lysine biosynthesis
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.25631-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_27714:complement(46..207)
AA seq 53 aa
XXXLSEIGIPAVNFGPGDALLAHTDNEHVRFSQLTRCHADLRAWLLSDRDDED

KEGG   T30397 (Metagenome): 25632
Entry
25632             CDS       T30397                                 

Definition
hypothetical protein
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Best hit
rmu:RMDY18_06070 (best score: 43.1282)
Pathway
00300  Lysine biosynthesis
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.25632-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_27714:complement(300..380)
AA seq 27 aa
KTLDEAVAHVREVFAGYELDXXXXXXX

DBGET integrated database retrieval system