KEGG   T30397 (Metagenome): 21314
Entry
21314             CDS       T30397                                 

Definition
hypothetical protein
  KO
K01783  ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Best hit
amy:ADJ76_03185 (best score: 102.064)
Taxonomy
Actinobacteria [GN:amy]
Pathway
00030  Pentose phosphate pathway
00040  Pentose and glucuronate interconversions
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.21314-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_24702:193..348
AA seq 52 aa
XXXXDVMDNHFVPNLSWGLPVAEAVVKSGILPVDAHLMIEDPDRWAPQYAEV

KEGG   T30397 (Metagenome): 27821
Entry
27821             CDS       T30397                                 

Gene name
rpe
Definition
ribulose-phosphate 3-epimerase
  KO
K01783  ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Best hit
vpr:Vpar_0855 (best score: 425.246)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00030  Pentose phosphate pathway
00040  Pentose and glucuronate interconversions
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.27821-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_29135:706..1356
AA seq 216 aa
MIKIAPSMLSANFAVLSEELKSIEAAGADLLHIDIMDGHFVPNLTFGAPIVKAIRPYTKL
PFDVHLMVTNPGDYVEEFAKIGVEYFTFHQETVPHMHRLIQHIKQCGMKAGVALNPSTPV
SLLEDVAADLDMILIMSVNPGFGGQSFIKNAIKKVKQAKILLEEVDNSTAVIEVDGGIND
ITCVPIKRAGATVLVAGSAVFGVEDRASMIESIRNN

KEGG   T30397 (Metagenome): 4313
Entry
4313              CDS       T30397                                 

Gene name
rpe
Definition
ribulose-phosphate 3-epimerase
  KO
K01783  ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Best hit
tpa:TP_0945 (best score: 48.9062)
Pathway
00030  Pentose phosphate pathway
00040  Pentose and glucuronate interconversions
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.4313-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_10630:complement(3..107)
AA seq 35 aa
XXXTFHIEAALHAHRLITEIRAAGMKPGVSIVPST

KEGG   T30397 (Metagenome): 4820
Entry
4820              CDS       T30397                                 

Gene name
rpe
Definition
ribulose-phosphate 3-epimerase
  KO
K01783  ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Best hit
jep:BW721_04310 (best score: 51.6026)
Pathway
00030  Pentose phosphate pathway
00040  Pentose and glucuronate interconversions
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.4820-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_11530:complement(157..321)
AA seq 55 aa
VALREEKGYHYLIEVDGGVNGETAKLCAAAGVDVAVAGSYVYYADDIXXXXXXXX

KEGG   T30397 (Metagenome): 6869
Entry
6869              CDS       T30397                                 

Gene name
rpe
Definition
ribulose-phosphate 3-epimerase
  KO
K01783  ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Best hit
lla:L0047 (best score: 58.9214)
Pathway
00030  Pentose phosphate pathway
00040  Pentose and glucuronate interconversions
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.6869-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_13883:1..120
AA seq 40 aa
HAEATPHIHGALQKIRSLGVKPSVVINPGTPVEAXXXXXX

KEGG   T30397 (Metagenome): 6870
Entry
6870              CDS       T30397                                 

Gene name
rpe
Definition
ribulose-phosphate 3-epimerase
  KO
K01783  ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Best hit
lla:L0047 (best score: 50.8322)
Pathway
00030  Pentose phosphate pathway
00040  Pentose and glucuronate interconversions
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.6870-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_13883:219..305
AA seq 29 aa
XXXVLVMTVNPGFGGQAFLPETMDKVREL

KEGG   T30397 (Metagenome): 7460
Entry
7460              CDS       T30397                                 

Definition
ribulose-phosphate 3-epimerase
  KO
K01783  ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Best hit
pmuc:ING2E5A_3086 (best score: 47.3654)
Pathway
00030  Pentose phosphate pathway
00040  Pentose and glucuronate interconversions
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.7460-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_14354:complement(1..117)
AA seq 39 aa
XXXXMKAAVTLNPHVPVELLVDVLADLDMVLLMSVNPGF

KEGG   T30397 (Metagenome): 7461
Entry
7461              CDS       T30397                                 

Gene name
rpe
Definition
ribulose-phosphate 3-epimerase
  KO
K01783  ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Best hit
pgi:PG_1595 (best score: 125.176)
Taxonomy
Bacteroidetes [GN:pgi]
Pathway
00030  Pentose phosphate pathway
00040  Pentose and glucuronate interconversions
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.7461-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_14354:complement(178..420)
AA seq 81 aa
MSKKQAIVSPSLLSANFLRLEEDVRLINQSEADWLHIDVMDGVFVPNISFGFPILEAIRP
IIEKPLDVHLMIVEPXXXXXX

DBGET integrated database retrieval system