KEGG   T30397 (Metagenome): 21803
Entry
21803             CDS       T30397                                 

Definition
YSIRK type signal peptide
  KO
K01676  fumarate hydratase, class I [EC:4.2.1.2]
Best hit
gha:NCTC10459_00043 (best score: 84.3445)
Pathway
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.21803-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_25052:3..173
AA seq 57 aa
QESKSGKDRFSELNTGTNTPDGTNVDWSTAKYSLEGADEEGKVVVPGEGTYXXXXXX

KEGG   T30397 (Metagenome): 12338
Entry
12338             CDS       T30397                                 

Definition
fumarate hydratase class I, anaerobic
  KO
K01676  fumarate hydratase, class I [EC:4.2.1.2]
Best hit
bbay:A4V04_05440 (best score: 72.7886)
Pathway
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.12338-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_18169:complement(3..122)
AA seq 40 aa
XMIAKGNRTQAVTDACQKHGGFYLGTIGGVAAVLSQSSIK

KEGG   T30397 (Metagenome): 2258
Entry
2258              CDS       T30397                                 

Definition
fumarate hydratase class I, anaerobic
  KO
K01676  fumarate hydratase, class I [EC:4.2.1.2]
Best hit
pru:PRU_0119 (best score: 125.176)
Taxonomy
Bacteroidetes [GN:pru]
Pathway
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.2258-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_6153:complement(199..429)
AA seq 77 aa
XXXXTIQNEGTLIPFLVEKMKSLGTAACPPYHICFVIGGTSAEKNLLTVKLGSIKYYDNL
PTTGDETGRXXXXXXXX

KEGG   T30397 (Metagenome): 12339
Entry
12339             CDS       T30397                                 

Definition
fumarate hydratase class I, anaerobic
  KO
K01676  fumarate hydratase, class I [EC:4.2.1.2]
Best hit
sutt:SUTMEG_20870 (best score: 87.0409)
Pathway
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.12339-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_18169:complement(175..324)
AA seq 50 aa
ELPDYIKNYPVLYAGPAKTPEGYPCGSMGPTTANRMDPYVDEXXXXXXXX

KEGG   T30397 (Metagenome): 30590
Entry
30590             CDS       T30397                                 

Definition
hydrolyase, tartrate alpha subunit/fumarate domain protein, Fe-S
type
  KO
K01677  fumarate hydratase subunit alpha [EC:4.2.1.2]
Best hit
vpr:Vpar_1529 (best score: 279.641)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.30590-T1-C
LinkDB
Position
C913687:complement(2..412)
AA seq 137 aa
DAEDRPYCQDTGMTMVFLKVGQDVHFVGGDLTEAINAGVAAGYVEGYLRKSVVAEPLFNR
KNTQNNTPAIIYTEIVPGDKVDIQVELKGFGSENKSDVAMLVPADGVEGVKNAVLEIVKH
AGPNPCPPIVLGIGIGG

KEGG   T30397 (Metagenome): 29122
Entry
29122             CDS       T30397                                 

Definition
hydro-lyase, Fe-S type, tartrate/fumarate subfamily, beta subunit
  KO
K01678  fumarate hydratase subunit beta [EC:4.2.1.2]
Best hit
vpr:Vpar_1528 (best score: 94.3597)
Pathway
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.29122-T1-C
LinkDB
Position
C908879:3..137
AA seq 44 aa
VLAYGELGPEALAELTVEDFPCIVVGDTEGNNFYELGQKPYRKI

KEGG   T30397 (Metagenome): 31099
Entry
31099             CDS       T30397                                 

Gene name
fumC
Definition
fumarate hydratase
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Best hit
vpr:Vpar_1657 (best score: 197.593)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
04934  Cushing syndrome
05200  Pathways in cancer
05211  Renal cell carcinoma
Other DBs
HMP: SRS019024.31099-T1-C
LinkDB
Position
C915333:161..460
AA seq 100 aa
METRIEYDSMGPVEVDARRIYGPQTQRSFNNFKIGDHRIPIEQIKALALVKKACALTNAK
CGAVTEEKAKLIAQVVDEIVDGKWDEEFPLTVFQTGSGTQ

KEGG   T30397 (Metagenome): 28692
Entry
28692             CDS       T30397                                 

Definition
fumarate hydratase (fumarase C),aerobic class II
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Best hit
aap:NT05HA_1233 (best score: 211.075)
Taxonomy
Gammaproteobacteria - Others [GN:aap]
Pathway
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
04934  Cushing syndrome
05200  Pathways in cancer
05211  Renal cell carcinoma
Other DBs
HMP: SRS019024.28692-T1-C
LinkDB
Position
C907330:3..314
AA seq 104 aa
ANDIRLLASGPRSGIGEILIPENEPGSSIMPGKVNPTQCEALTMVCAQVFGNDTTISFVG
SQGHFQLNVFNPVMVANFLQSAQLLGDACVSFDEHCATGIQPNY

KEGG   T30397 (Metagenome): 22076
Entry
22076             CDS       T30397                                 

Gene name
fumC
Definition
fumarate hydratase
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Best hit
vpr:Vpar_1657 (best score: 96.6709)
Pathway
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
04934  Cushing syndrome
05200  Pathways in cancer
05211  Renal cell carcinoma
Other DBs
HMP: SRS019024.22076-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_25243:complement(4..159)
AA seq 51 aa
MIATSLTPYIGYDKSTKIVKEPYKRGCSIKEIILEEKLMTEDEFGEAVRMK

KEGG   T30397 (Metagenome): 387
Entry
387               CDS       T30397                                 

Definition
fumarate hydratase, class II
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Best hit
pbo:PACID_33440 (best score: 70.8626)
Pathway
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
04934  Cushing syndrome
05200  Pathways in cancer
05211  Renal cell carcinoma
Other DBs
HMP: SRS019024.387-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_1086:214..324
AA seq 37 aa
XXXTESDSMGTIEVPADHYWGAQTERSLHNFDIGRNT

KEGG   T30397 (Metagenome): 18453
Entry
18453             CDS       T30397                                 

Gene name
fumC
Definition
fumarate hydratase class II
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Best hit
pmu:PM0823 (best score: 87.0409)
Pathway
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
04934  Cushing syndrome
05200  Pathways in cancer
05211  Renal cell carcinoma
Other DBs
HMP: SRS019024.18453-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_22634:complement(1..147)
AA seq 49 aa
XXXAQLDFGLRALRNTLPHLSQLALGGTAVGTGLNTPKGYDVKVADYIA

KEGG   T30397 (Metagenome): 19677
Entry
19677             CDS       T30397                                 

Definition
fumarate hydratase
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Best hit
ppc:HMPREF9154_1099 (best score: 179.874)
Taxonomy
Actinobacteria [GN:ppc]
Pathway
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
04934  Cushing syndrome
05200  Pathways in cancer
05211  Renal cell carcinoma
Other DBs
HMP: SRS019024.19677-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_23531:complement(199..489)
AA seq 97 aa
MPGKVNPTQCEAMTMVATQVFGNDATVGFAGSQGNFQLNVFKPVMAWCVLESIQLLGDTC
VSFDTNCAYGIEPNTERIKANLETNLMQVTAXXXXXX

KEGG   T30397 (Metagenome): 10607
Entry
10607             CDS       T30397                                 

Gene name
fumC
Definition
fumarate hydratase class II
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Best hit
cgl:NCgl0967 (best score: 58.5362)
Pathway
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
04934  Cushing syndrome
05200  Pathways in cancer
05211  Renal cell carcinoma
Other DBs
HMP: SRS019024.10607-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_16851:3..134
AA seq 44 aa
SSNDTFPTATHIAATEAAVTVLIPALKVLHDSLAAKAXXXXXXX

KEGG   T30397 (Metagenome): 32859
Entry
32859             CDS       T30397                                 

Definition
fumarate hydratase
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Best hit
rmu:RMDY18_16160 (best score: 558.525)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
04934  Cushing syndrome
05200  Pathways in cancer
05211  Renal cell carcinoma
Other DBs
HMP: SRS019024.32859-T1-C
LinkDB
Position
C919790:235..1116
AA seq 294 aa
MAENIEYRIEHDTMGEVRVPADALYRAQTQRAVENFPISGQTLESAHIRALALVKKAAAT
ANEELKVLDAERAQAIRDAADLVATGKYDAHFPIDVFQTGSGTSSNMNANEVLATLATRS
LESKGIEVHPNDHVNASQSSNDVFPTSVHVAVTEALVKDLIPALEVLAESLERKSAEFKD
VVKSGRTHLMDATPITLGQEFSGYAATVRYGIERVNASLPRVAEVPLGGTAVGTGINTPA
GFSARVIELLAEETGLPLTEARNHFEAQANRDGLIEVSGQLRTLAYGLMKISND

KEGG   T30397 (Metagenome): 29836
Entry
29836             CDS       T30397                                 

Definition
fumarate hydratase
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Best hit
amy:ADJ76_01730 (best score: 130.183)
Taxonomy
Actinobacteria [GN:amy]
Pathway
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
04934  Cushing syndrome
05200  Pathways in cancer
05211  Renal cell carcinoma
Other DBs
HMP: SRS019024.29836-T1-C
LinkDB
Position
C911249:complement(1..198)
AA seq 66 aa
VAQETRTETDSMGAVEVPANRYWGAQTERSLHNFDIGRNTFVWGRPMVRALGILKKSAAL
ANAELG

KEGG   T30397 (Metagenome): 20204
Entry
20204             CDS       T30397                                 

Gene name
fumC
Definition
fumarate hydratase, class-II
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Best hit
pfr:PFREUD_16300 (best score: 98.5969)
Pathway
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
04934  Cushing syndrome
05200  Pathways in cancer
05211  Renal cell carcinoma
Other DBs
HMP: SRS019024.20204-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_23928:2..172
AA seq 57 aa
ELAGGQMGTKTPVHPNDHVNRGQSSNDTFPTAMHIAVVSELQEMYPKVTXXXXXXXX

KEGG   T30397 (Metagenome): 2989
Entry
2989              CDS       T30397                                 

Definition
fumarate hydratase (fumarase C),aerobic class II
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Best hit
aap:NT05HA_1233 (best score: 47.7506)
Pathway
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
04934  Cushing syndrome
05200  Pathways in cancer
05211  Renal cell carcinoma
Other DBs
HMP: SRS019024.2989-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_7877:complement(227..328)
AA seq 34 aa
VVEHTIPCVERLQKTFAKKSAEFKDVXXXXXXXX

KEGG   T30397 (Metagenome): 19678
Entry
19678             CDS       T30397                                 

Gene name
fumC
Definition
fumarate hydratase
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Best hit
amy:ADJ76_01730 (best score: 103.219)
Taxonomy
Actinobacteria [GN:amy]
Pathway
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
04934  Cushing syndrome
05200  Pathways in cancer
05211  Renal cell carcinoma
Other DBs
HMP: SRS019024.19678-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_23531:complement(522..725)
AA seq 67 aa
ELAIGGTAVGTGLNAHPKFGELTAKKISEETGIEFKQADNLFAALGAHDALVXXXXTPPA
RVTASAS

KEGG   T30397 (Metagenome): 2988
Entry
2988              CDS       T30397                                 

Gene name
fumC
Definition
fumarate hydratase class II
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Best hit
apag:EIA51_07455 pmu:PM0823 hin:HI1398 (best score: 66.2402)
Pathway
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
04934  Cushing syndrome
05200  Pathways in cancer
05211  Renal cell carcinoma
Other DBs
HMP: SRS019024.2988-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_7877:complement(2..103)
AA seq 34 aa
XGQEFSAYAAQLDFGLRALRNTLPHLSQLALGGT

KEGG   T30397 (Metagenome): 18454
Entry
18454             CDS       T30397                                 

Gene name
fumC
Definition
fumarate hydratase class II
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Best hit
aap:NT05HA_1233 (best score: 96.2857)
Pathway
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
04934  Cushing syndrome
05200  Pathways in cancer
05211  Renal cell carcinoma
Other DBs
HMP: SRS019024.18454-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_22634:complement(241..399)
AA seq 53 aa
ACDEILAGKLDDQFPLVIWQTGSGTQSNMNVNEVVANRAHVLHGGKLXXXXXX

KEGG   T30397 (Metagenome): 22798
Entry
22798             CDS       T30397                                 

Gene name
fumC
Definition
fumarate hydratase class II
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Best hit
ppc:HMPREF9154_1099 (best score: 126.331)
Taxonomy
Actinobacteria [GN:ppc]
Pathway
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
04934  Cushing syndrome
05200  Pathways in cancer
05211  Renal cell carcinoma
Other DBs
HMP: SRS019024.22798-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_25746:complement(3..308)
AA seq 102 aa
MTTDAKTPNQAVTTRTESDSMGTIGVDANRYWGAXXXXXXXXXXXXXXXAQTERSLHNFD
IGRETFVWGRPMIKALGILKKSAALANAELGELPADIAELIA

KEGG   T30397 (Metagenome): 19676
Entry
19676             CDS       T30397                                 

Definition
fumarate hydratase
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Best hit
acq:AM609_08875 (best score: 68.9366)
Pathway
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
04934  Cushing syndrome
05200  Pathways in cancer
05211  Renal cell carcinoma
Other DBs
HMP: SRS019024.19676-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_23531:complement(31..153)
AA seq 40 aa
XXXKGLSLRESALELGFVTAEEFDKWVVPMDMTHPSAAED

DBGET integrated database retrieval system