KEGG   T30397 (Metagenome): 21963
Entry
21963             CDS       T30397                                 

Gene name
rpiA
Definition
ribose 5-phosphate isomerase A
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Best hit
spy:SPy_0889 (best score: 207.223)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00030  Pentose phosphate pathway
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.21963-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_25161:complement(3..398)
AA seq 132 aa
EEIGRRIKEEGLQITAVTTSSVTSKQAEGLNIPLKSIDQVDFVDVTVDGADEVDSQFNGI
KGGGGALLMEKVVATPSKEYIWVVDESKLVDKLGAFKLPVEVVQYGAEQVFRRFERAGYK
PSFREKDGQRFV

KEGG   T30397 (Metagenome): 25609
Entry
25609             CDS       T30397                                 

Definition
ribose 5-phosphate isomerase
  KO
K01808  ribose 5-phosphate isomerase B [EC:5.3.1.6]
Best hit
ske:Sked_24510 (best score: 66.2402)
Pathway
00030  Pentose phosphate pathway
00051  Fructose and mannose metabolism
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.25609-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_27699:complement(1..105)
AA seq 35 aa
MRIHIASDHAGYELKSAVIEHLREQGHDVIDHGAH

KEGG   T30397 (Metagenome): 31803
Entry
31803             CDS       T30397                                 

Definition
hypothetical protein
  KO
K01808  ribose 5-phosphate isomerase B [EC:5.3.1.6]
Best hit
vpr:Vpar_1094 (best score: 66.6254)
Pathway
00030  Pentose phosphate pathway
00051  Fructose and mannose metabolism
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.31803-T1-C
LinkDB
Position
C917375:474..569
AA seq 32 aa
MKVAIGCDHGGLHLKASVKELLNALGHEVEDF

KEGG   T30397 (Metagenome): 6240
Entry
6240              CDS       T30397                                 

Definition
ribose 5-phosphate isomerase
  KO
K01808  ribose 5-phosphate isomerase B [EC:5.3.1.6]
Best hit
ppc:HMPREF9154_0699 (best score: 109.383)
Taxonomy
Actinobacteria [GN:ppc]
Pathway
00030  Pentose phosphate pathway
00051  Fructose and mannose metabolism
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.6240-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_13311:complement(214..402)
AA seq 63 aa
LLTVRGSVENYDAQVLCMGQNVIAAPAAWALIDIWLDLRHDPTSSYGPKVGEIAAYXXXX
XXX

DBGET integrated database retrieval system