KEGG   T30397 (Metagenome): 22712
Entry
22712             CDS       T30397                                 

Definition
hypothetical protein
  KO
K00895  diphosphate-dependent phosphofructokinase [EC:2.7.1.90]
Best hit
amy:ADJ76_03840 (best score: 89.7373)
Pathway
00010  Glycolysis / Gluconeogenesis
00030  Pentose phosphate pathway
00051  Fructose and mannose metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS019024.22712-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_25688:2..187
AA seq 62 aa
LTNLRKVTFMSVRRVALLTAGGFAPCLSSAVGGLIERYNEIDPTVEIIAYQNGYXXXXXX
XX

KEGG   T30397 (Metagenome): 26730
Entry
26730             CDS       T30397                                 

Definition
hypothetical protein
  KO
K00895  diphosphate-dependent phosphofructokinase [EC:2.7.1.90]
Best hit
dori:FH5T_22110 (best score: 42.3578)
Pathway
00010  Glycolysis / Gluconeogenesis
00030  Pentose phosphate pathway
00051  Fructose and mannose metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS019024.26730-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_28446:complement(276..365)
AA seq 30 aa
HNVIAGLFDGLKKIHPDSRLYGXXXXXXXX

KEGG   T30397 (Metagenome): 6826
Entry
6826              CDS       T30397                                 

Definition
pyrophosphate--fructose-6-phosphate 1-phosphotransferase
  KO
K00895  diphosphate-dependent phosphofructokinase [EC:2.7.1.90]
Best hit
acq:AM609_05540 (best score: 70.8626)
Pathway
00010  Glycolysis / Gluconeogenesis
00030  Pentose phosphate pathway
00051  Fructose and mannose metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS019024.6826-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_13844:complement(1..111)
AA seq 37 aa
XXXAAVGDLIERYTQVAPEVEIIAYQYGYHGLLTGNY

KEGG   T30397 (Metagenome): 26729
Entry
26729             CDS       T30397                                 

Definition
diphosphate-fructose-6-phosphate 1-phosphotransferase
  KO
K00895  diphosphate-dependent phosphofructokinase [EC:2.7.1.90]
Best hit
tfo:BFO_0230 (best score: 140.969)
Taxonomy
Bacteroidetes [GN:tfo]
Pathway
00010  Glycolysis / Gluconeogenesis
00030  Pentose phosphate pathway
00051  Fructose and mannose metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS019024.26729-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_28446:complement(1..243)
AA seq 81 aa
XXXGFDIIGSGRTKLEETAQFDKGLEILKKLDIRALVIIGGDDSNTNAAVLAEYYKSIGA
PVQVIGCPKTIDGDLKNEQIE

KEGG   T30397 (Metagenome): 683
Entry
683               CDS       T30397                                 

Definition
6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Best hit
actt:DDD63_05125 (best score: 125.561)
Taxonomy
Actinobacteria [GN:actt]
Pathway
00010  Glycolysis / Gluconeogenesis
00030  Pentose phosphate pathway
00051  Fructose and mannose metabolism
00052  Galactose metabolism
00680  Methane metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.683-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_1925:803..1003
AA seq 67 aa
MVPTIVDNCEKDGIDALVCLGGGGTAKNAKRLMDAGLNVIHLPKTIDNDIVHTDSSFGFA
TALEIAT

KEGG   T30397 (Metagenome): 682
Entry
682               CDS       T30397                                 

Definition
6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Best hit
ane:AN27039_2675 (best score: 75.8701)
Pathway
00010  Glycolysis / Gluconeogenesis
00030  Pentose phosphate pathway
00051  Fructose and mannose metabolism
00052  Galactose metabolism
00680  Methane metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.682-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_1925:600..731
AA seq 44 aa
XQHGWELVGFRDGMRGLAENRFTELDPAALSGILTTGXXXXXXX

DBGET integrated database retrieval system