KEGG   T30397 (Metagenome): 22962
Entry
22962             CDS       T30397                                 

Definition
L-serine dehydratase, iron-sulfur-dependent, beta subunit
  KO
K01752  L-serine dehydratase [EC:4.3.1.17]
Best hit
vpr:Vpar_1523 (best score: 212.616)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00260  Glycine, serine and threonine metabolism
00270  Cysteine and methionine metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.22962-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_25856:557..880
AA seq 108 aa
MNSIFDIIGPIMIGPSSSHTAGAARLGKMARCIFRSTPKKVDLTLYGSFAKTYKGHGTDR
ALIGGLLGYKEDDANIRVAHELAKKEGMEFSFIESPLDVGHPNVVRFD

KEGG   T30397 (Metagenome): 10814
Entry
10814             CDS       T30397                                 

Gene name
sdaAA
Definition
L-serine dehydratase, iron-sulfur-dependent, alpha subunit
  KO
K01752  L-serine dehydratase [EC:4.3.1.17]
Best hit
spy:SPy_2190 (best score: 67.3958)
Pathway
00260  Glycine, serine and threonine metabolism
00270  Cysteine and methionine metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.10814-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_17000:complement(187..312)
AA seq 42 aa
AFVIKNMLGLICDPVAGLVEVPCVKRNAMGASFAXXXXXXXX

KEGG   T30397 (Metagenome): 3835
Entry
3835              CDS       T30397                                 

Gene name
sdhB
Definition
L-serine dehydratase, iron-sulfur-dependent, beta subunit
  KO
K01752  L-serine dehydratase [EC:4.3.1.17]
Best hit
mps:MPTP_1953 mps:MPTP_1948 (best score: 51.9878)
Pathway
00260  Glycine, serine and threonine metabolism
00270  Cysteine and methionine metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.3835-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_9625:complement(3..107)
AA seq 35 aa
XXXSHTAGAIAIGALARQLFGGTPKNVRCDYYESF

KEGG   T30397 (Metagenome): 27483
Entry
27483             CDS       T30397                                 

Definition
L-serine ammonia-lyase beta subunit
  KO
K01752  L-serine dehydratase [EC:4.3.1.17]
Best hit
rcu:8261982 (best score: 189.504)
Taxonomy
Eudicots [GN:rcu]
Pathway
00260  Glycine, serine and threonine metabolism
00270  Cysteine and methionine metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.27483-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_28932:complement(2..373)
AA seq 124 aa
GILGMDTDDPDIPNSLEIAHKRGIKIVWTIQKDSNAPHPNTTKITVKNEHKSISVTGISI
GGGNIQVTELNGFAVSLNMNTPTIIIVHQDVPGMIAHVTEALSRFDINIAQMNVTREKAG
EKAI

KEGG   T30397 (Metagenome): 29659
Entry
29659             CDS       T30397                                 

Definition
L-serine dehydratase, iron-sulfur-dependent, beta subunit
  KO
K01752  L-serine dehydratase [EC:4.3.1.17]
Best hit
vpr:Vpar_1523 (best score: 235.728)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00260  Glycine, serine and threonine metabolism
00270  Cysteine and methionine metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.29659-T1-C
LinkDB
Position
C910633:1..354
AA seq 118 aa
HPNVVRFDMYDEHNRHMTVIGRSLGGGQIMITEVDGNDMSITGDEFTLVVFHEDRPGAIS
LVSQALSESDINIATMRVFRKGKHKDAVMVITTDTVVNPITVQFMREFPGIQDVMTFE

KEGG   T30397 (Metagenome): 28442
Entry
28442             CDS       T30397                                 

Definition
L-serine ammonia-lyase beta subunit
  KO
K01752  L-serine dehydratase [EC:4.3.1.17]
Best hit
spy:SPy_2189 (best score: 140.969)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00260  Glycine, serine and threonine metabolism
00270  Cysteine and methionine metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.28442-T1-C
LinkDB
Position
C906510:49..309
AA seq 87 aa
MHSLRFQSVFDIIGPVMIGPSSSHTAGAVRIGKIVSSIFDDTPTEVEFQLFNSFAKTYRG
HGTDLALVAGILGMDTDDPNIPNSLEI

KEGG   T30397 (Metagenome): 19860
Entry
19860             CDS       T30397                                 

Gene name
sdaAA
Definition
L-serine dehydratase, iron-sulfur-dependent, alpha subunit
  KO
K01752  L-serine dehydratase [EC:4.3.1.17]
Best hit
vpr:Vpar_1522 (best score: 195.667)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00260  Glycine, serine and threonine metabolism
00270  Cysteine and methionine metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.19860-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_23670:complement(1..309)
AA seq 103 aa
VADHYQLDRATVVKGFLAASGIGNVVANRACVAGAVGGCQAEIGTAACMAAGAIVEMMGG
SPRQVGHAIALCMKNLLGLACDPVAGLVEVPCVKRNGFYAVHA

KEGG   T30397 (Metagenome): 32407
Entry
32407             CDS       T30397                                 

Definition
L-serine ammonia-lyase
  KO
K01752  L-serine dehydratase [EC:4.3.1.17]
Best hit
rmu:RMDY18_04610 (best score: 227.254)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00260  Glycine, serine and threonine metabolism
00270  Cysteine and methionine metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.32407-T1-C
LinkDB
Position
C918891:complement(370..744)
AA seq 124 aa
SISGAEVGCQGEVGSASSMAAAGLAQVLGGTPEQVENAAEIAMEHNLGLTCDPVGGLVQI
PCIERNAMAASNAVTAARMALRGDGMHRVSLDQVIETMRQTGLDMSHRYKETSMGGLAVN
VVEC

KEGG   T30397 (Metagenome): 22694
Entry
22694             CDS       T30397                                 

Gene name
sdhA
Definition
L-serine dehydratase, iron-sulfur-dependent, alpha subunit
  KO
K01752  L-serine dehydratase [EC:4.3.1.17]
Best hit
efa:EF0099 (best score: 97.0561)
Pathway
00260  Glycine, serine and threonine metabolism
00270  Cysteine and methionine metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.22694-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_25674:209..409
AA seq 67 aa
XXXRGKTLSGDSILAGVQYALGTNEVNAAMGLVCATPTAGASGTLPGVVFSIADTMNLNH
EQQVRFL

KEGG   T30397 (Metagenome): 32350
Entry
32350             CDS       T30397                                 

Definition
L-serine ammonia-lyase
  KO
K01752  L-serine dehydratase [EC:4.3.1.17]
Best hit
spy:SPy_2189 (best score: 145.591)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00260  Glycine, serine and threonine metabolism
00270  Cysteine and methionine metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.32350-T1-C
LinkDB
Position
C918773:455..721
AA seq 89 aa
MKSLRFQSVFDIIGPVMIGPSSSHTAGAVRIGKIVSSIFDDTPTEVEFQLFNSFAKTYRG
HGTDLALVAGILGMDTDDPEIPNSLEIAH

KEGG   T30397 (Metagenome): 29652
Entry
29652             CDS       T30397                                 

Definition
L-serine ammonia-lyase
  KO
K01752  L-serine dehydratase [EC:4.3.1.17]
Best hit
rmu:RMDY18_04610 (best score: 231.491)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00260  Glycine, serine and threonine metabolism
00270  Cysteine and methionine metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.29652-T1-C
LinkDB
Position
C910615:complement(3..356)
AA seq 118 aa
VLPRHTNGMKIAAFAGEQLLLERTYYSIGGGFIVEGDEEATCGASLMNPPYPFGSAAELL
EMANEAGLSIAQLKMANECSLRSEQEVRDGILHIYRVMKECIGSSLARVGYLPGPLKV

KEGG   T30397 (Metagenome): 16456
Entry
16456             CDS       T30397                                 

Definition
hypothetical protein
  KO
K01752  L-serine dehydratase [EC:4.3.1.17]
Best hit
vpr:Vpar_1522 (best score: 84.7297)
Pathway
00260  Glycine, serine and threonine metabolism
00270  Cysteine and methionine metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.16456-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_21191:3..152
AA seq 50 aa
VHAITASELALMNIESQIPPDEVIEAMNNIGRAMPAALRETSDXXXXXXX

KEGG   T30397 (Metagenome): 335
Entry
335               CDS       T30397                                 

Definition
L-serine dehydratase 1
  KO
K01752  L-serine dehydratase [EC:4.3.1.17]
Best hit
acq:AM609_13590 (best score: 60.8474)
Pathway
00260  Glycine, serine and threonine metabolism
00270  Cysteine and methionine metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.335-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_912:1..120
AA seq 40 aa
DDGVRRFMLAATAVGALIKTNASIAGAEVGCQGXXXXXXX

KEGG   T30397 (Metagenome): 30489
Entry
30489             CDS       T30397                                 

Definition
L-serine ammonia-lyase
  KO
K01752  L-serine dehydratase [EC:4.3.1.17]
Best hit
rmu:RMDY18_04610 (best score: 125.946)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00260  Glycine, serine and threonine metabolism
00270  Cysteine and methionine metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.30489-T1-C
LinkDB
Position
C913349:208..402
AA seq 65 aa
VAINQSTPSSAQKKAEALPYDISVFEMFSIGVGPSSSHTVGPMRASNRFVAELIDEGLLD
RVTGV

KEGG   T30397 (Metagenome): 7753
Entry
7753              CDS       T30397                                 

Gene name
sdaA
Definition
L-serine ammonia-lyase
  KO
K01752  L-serine dehydratase [EC:4.3.1.17]
Best hit
rpne:NCTC8284_01189 (best score: 84.7297)
Pathway
00260  Glycine, serine and threonine metabolism
00270  Cysteine and methionine metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.7753-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_14610:complement(156..317)
AA seq 54 aa
KFDAVATLHVDVYGSLSMTGHGHNTDIAIIMGLAGYLPHDVDIDLIPXXXXXXX

KEGG   T30397 (Metagenome): 7752
Entry
7752              CDS       T30397                                 

Definition
L-serine deaminase I
  KO
K01752  L-serine dehydratase [EC:4.3.1.17]
Best hit
paet:NCTC13378_02048 (best score: 55.8398)
Pathway
00260  Glycine, serine and threonine metabolism
00270  Cysteine and methionine metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.7752-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_14610:complement(3..113)
AA seq 37 aa
XXXIAQGKKTVNFDWDANMVFHNSFLSLHENGMTITA

KEGG   T30397 (Metagenome): 26118
Entry
26118             CDS       T30397                                 

Definition
hypothetical protein
  KO
K01752  L-serine dehydratase [EC:4.3.1.17]
Best hit
vpr:Vpar_1522 (best score: 151.369)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00260  Glycine, serine and threonine metabolism
00270  Cysteine and methionine metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.26118-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_28039:295..528
AA seq 78 aa
MSDIAYKAMTYAIAVNEANAKMFRIVACPTAGSCGVMPGAVKAVADYYKLDRATMVKGFL
AASGIGNVVANRACVAGA

KEGG   T30397 (Metagenome): 14592
Entry
14592             CDS       T30397                                 

Definition
L-serine ammonia-lyase
  KO
K01752  L-serine dehydratase [EC:4.3.1.17]
Best hit
spy:SPy_2189 (best score: 70.8626)
Pathway
00260  Glycine, serine and threonine metabolism
00270  Cysteine and methionine metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.14592-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_19834:complement(1..129)
AA seq 43 aa
XFFDIIGPVMIGPSSSHTAGAVRIGKIVYSIFNDEPTEVEFQL

KEGG   T30397 (Metagenome): 28327
Entry
28327             CDS       T30397                                 

Gene name
sdaAA
Definition
L-serine dehydratase, iron-sulfur-dependent, alpha subunit
  KO
K01752  L-serine dehydratase [EC:4.3.1.17]
Best hit
vpr:Vpar_1522 (best score: 193.356)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00260  Glycine, serine and threonine metabolism
00270  Cysteine and methionine metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.28327-T1-C
LinkDB
Position
C906076:complement(2..304)
AA seq 101 aa
IIRLGEENNISFGDVVLRYELENYDRSEDAVVREIENRLDIFESSIQDGIAYAEKTASGM
SGGQAAQLNGQTPRFMSDIAYKAMTYAIAVNEANAKMFRIV

KEGG   T30397 (Metagenome): 29069
Entry
29069             CDS       T30397                                 

Definition
L-serine ammonia-lyase
  KO
K01752  L-serine dehydratase [EC:4.3.1.17]
Best hit
rmu:RMDY18_04610 (best score: 217.624)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00260  Glycine, serine and threonine metabolism
00270  Cysteine and methionine metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.29069-T1-C
LinkDB
Position
C908704:2..331
AA seq 110 aa
GPLKVRCRAGAWHRDLMVEDPGKSPEFAIDWVNLIALAVNEENAFGGRVVTAPTNGASGI
IPAVLHYAMNYTPGIRHCGQAAREQAIVDFFLASAAVGVLYKKRASISGA

KEGG   T30397 (Metagenome): 18067
Entry
18067             CDS       T30397                                 

Gene name
ilvA
Definition
threonine ammonia-lyase
  KO
K01754  threonine dehydratase [EC:4.3.1.19]
Best hit
vpr:Vpar_1440 (best score: 268.855)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00260  Glycine, serine and threonine metabolism
00290  Valine, leucine and isoleucine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.18067-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_22355:3..404
AA seq 134 aa
DECGNDVYIKPENLQITGSFKVRGAYNKIAKLTEEEKARGVIAASAGNHAQGVALAAKRL
GIKATIVMPKHTPLIKVNATKQYGADVVLFGEIYDEAYQKAMELQKEHGYVFVHPFNDED
VIEGQGTIALEVLD

KEGG   T30397 (Metagenome): 24865
Entry
24865             CDS       T30397                                 

Definition
threonine ammonia-lyase
  KO
K01754  threonine dehydratase [EC:4.3.1.19]
Best hit
rmu:RMDY18_16250 (best score: 179.489)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00260  Glycine, serine and threonine metabolism
00290  Valine, leucine and isoleucine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.24865-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_27188:3..278
AA seq 91 aa
LKVIQRGLSAAGRYMTIKMMLSDRPGELATISRIISENDANVTGVDHTRVGGSLSMGDVS
ITIDMETKGVEHCRQVISALEDEGFKPIIVY

KEGG   T30397 (Metagenome): 28648
Entry
28648             CDS       T30397                                 

Gene name
ilvA
Definition
C-terminal regulatory domain of threonine dehydratase
  KO
K01754  threonine dehydratase [EC:4.3.1.19]
Best hit
spn:SP_0450 (best score: 206.838)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00260  Glycine, serine and threonine metabolism
00290  Valine, leucine and isoleucine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.28648-T1-C
LinkDB
Position
C907198:complement(2..313)
AA seq 104 aa
VLSDYIKGKTICCIISGGNNDINRMPEMEERALIYDGIKHYFVVNFPQRPGALREFVNDI
LGPNDDITRFEYIKRASKGTGPVLIGVALANKHDYAGLIHRMEK

KEGG   T30397 (Metagenome): 192
Entry
192               CDS       T30397                                 

Definition
threonine ammonia-lyase
  KO
K01754  threonine dehydratase [EC:4.3.1.19]
Best hit
fnu:FN1411 (best score: 110.923)
Taxonomy
Fusobacteria [GN:fnu]
Pathway
00260  Glycine, serine and threonine metabolism
00290  Valine, leucine and isoleucine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.192-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_553:164..355
AA seq 64 aa
XARELGIKAVIVMPKSTPLIKVESTKQYGAEVVLHGDVYDDAYKKAKELEEKESYVFVHP
FNDE

KEGG   T30397 (Metagenome): 6659
Entry
6659              CDS       T30397                                 

Gene name
ilvA
Definition
threonine dehydratase biosynthetic
  KO
K01754  threonine dehydratase [EC:4.3.1.19]
Best hit
hin:HI0738.1 (best score: 65.4698)
Pathway
00260  Glycine, serine and threonine metabolism
00290  Valine, leucine and isoleucine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.6659-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_13693:3..119
AA seq 39 aa
DGMVLVDSDEVCAAMKDLFENVRAVAEPSGALGXXXXXX

KEGG   T30397 (Metagenome): 6660
Entry
6660              CDS       T30397                                 

Gene name
ilvA
Definition
threonine dehydratase biosynthetic
  KO
K01754  threonine dehydratase [EC:4.3.1.19]
Best hit
hin:HI0738.1 (best score: 80.8777)
Pathway
00260  Glycine, serine and threonine metabolism
00290  Valine, leucine and isoleucine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.6660-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_13693:175..306
AA seq 44 aa
XXXXVKQNNLEGKNMAAILSGANLNFHTLRYVSERCEIGENREA

KEGG   T30397 (Metagenome): 24464
Entry
24464             CDS       T30397                                 

Definition
threonine ammonia-lyase
  KO
K01754  threonine dehydratase [EC:4.3.1.19]
Best hit
spn:SP_0450 (best score: 119.398)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00260  Glycine, serine and threonine metabolism
00290  Valine, leucine and isoleucine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.24464-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_26912:2..199
AA seq 66 aa
IFMPITTPQQKIGQVRFFGGDYVTIKLVGDTFDASAKAAQEFTVSENRTFIDPFDDAHVX
XXXXXX

DBGET integrated database retrieval system