KEGG   T30397 (Metagenome): 23301
Entry
23301             CDS       T30397                                 

Definition
acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Best hit
rmu:RMDY18_18340 (best score: 515.383)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00010  Glycolysis / Gluconeogenesis
00620  Pyruvate metabolism
00630  Glyoxylate and dicarboxylate metabolism
00640  Propanoate metabolism
00680  Methane metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.23301-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_26100:complement(433..1212)
AA seq 260 aa
AEALKFRVEDTGAKVLVTTDGQNRRGKVVPVKVNADEACSGENNIEHVIVVDRTSASDPV
AHAEVPWTEGRDVWYHDLVDDQPDTHAYELHDAEDPLFIIYTSGTTGKPKGLVHTMGGYL
VQTAYTHALLYDLLPDYVDENGVLRPDELSAVNDPEKVESTVHWCTADLAWVTAHTYEIY
GPLVNGVSEVIYEGTPNTPHYGRHFEVIERYGVTNYYTAPTLIRSLMGAFPDGPEPGKYD
FSTVRLLGSVGEXXXXXXXX

KEGG   T30397 (Metagenome): 23299
Entry
23299             CDS       T30397                                 

Definition
acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Best hit
rmu:RMDY18_18340 (best score: 67.3958)
Pathway
00010  Glycolysis / Gluconeogenesis
00620  Pyruvate metabolism
00630  Glyoxylate and dicarboxylate metabolism
00640  Propanoate metabolism
00680  Methane metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.23299-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_26100:complement(2..106)
AA seq 35 aa
XXXLAGDGAKEDEEGNVYILGRIDDVINISGHRLS

KEGG   T30397 (Metagenome): 17792
Entry
17792             CDS       T30397                                 

Definition
AMP-binding protein
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Best hit
pru:PRU_2205 (best score: 86.6557)
Pathway
00010  Glycolysis / Gluconeogenesis
00620  Pyruvate metabolism
00630  Glyoxylate and dicarboxylate metabolism
00640  Propanoate metabolism
00680  Methane metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.17792-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_22170:complement(1..141)
AA seq 47 aa
XGQWFAGATVFVYDHEKFSAEKIMRMMEKYRITSFCAPPTIYRFMLQ

KEGG   T30397 (Metagenome): 17793
Entry
17793             CDS       T30397                                 

Definition
AMP-binding enzyme
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Best hit
pru:PRU_2205 (best score: 75.485)
Pathway
00010  Glycolysis / Gluconeogenesis
00620  Pyruvate metabolism
00630  Glyoxylate and dicarboxylate metabolism
00640  Propanoate metabolism
00680  Methane metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.17793-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_22170:complement(189..344)
AA seq 52 aa
KAPAFVRPEEVNVNEDTMLMYFTSGTSGEPKMVAHDHLYALGHLXXXXXXXX

KEGG   T30397 (Metagenome): 23300
Entry
23300             CDS       T30397                                 

Definition
acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Best hit
rmu:RMDY18_18340 (best score: 129.028)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00010  Glycolysis / Gluconeogenesis
00620  Pyruvate metabolism
00630  Glyoxylate and dicarboxylate metabolism
00640  Propanoate metabolism
00680  Methane metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.23300-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_26100:complement(184..405)
AA seq 74 aa
XXXRPHDPAFASAGTYPVGTPHCTPLPGCATRAVPGVSTRVVDEHGNPVEPGKQGFIVVD
KIGPSMXXXXXXXX

DBGET integrated database retrieval system