KEGG   T30397 (Metagenome): 23347
Entry
23347             CDS       T30397                                 

Definition
putative bacterial lipid A biosynthesis acyltransferase
  KO
K02517  Kdo2-lipid IVA lauroyltransferase/acyltransferase [EC:2.3.1.241 2.3.1.-]
Best hit
vpr:Vpar_0532 (best score: 399.823)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00540  Lipopolysaccharide biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS019024.23347-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_26133:complement(2..601)
AA seq 200 aa
KASTTRFGRMIIDVLRYPEIKDGAYKDMVEFINREYLDDALENGRGAILAAVHSGNWELL
GGVLASEGYPLISVAMKQNGDADKFINEYRRIMHQHVTYKTGVREMINELKKGAFLGLIM
DQDPGDDGVLAPFFGYETLTAAGPAVLARMQDVPIIFVTIHYSPFSEKHEIEAHPPIYVE
RTDDKKRDIAVTTTRLNEFI

KEGG   T30397 (Metagenome): 25045
Entry
25045             CDS       T30397                                 

Definition
hypothetical protein
  KO
K02517  Kdo2-lipid IVA lauroyltransferase/acyltransferase [EC:2.3.1.241 2.3.1.-]
Best hit
vpr:Vpar_0532 (best score: 240.736)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00540  Lipopolysaccharide biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS019024.25045-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_27312:complement(1..363)
AA seq 121 aa
MKIFSAFICLLPKGLQYAIGTLLGEIAWLAVPPKRKRLAIGQILFCNITDDPKEARRIAK
ASTTRFGRMIIDVLRYPEIKDGAYKDMVEFINKEYLDDALENGRGAILAAVHSGNWELLG
G

KEGG   T30397 (Metagenome): 31820
Entry
31820             CDS       T30397                                 

Definition
lipid A biosynthesis acyltransferase
  KO
K02517  Kdo2-lipid IVA lauroyltransferase/acyltransferase [EC:2.3.1.241 2.3.1.-]
Best hit
vpr:Vpar_0546 (best score: 191.43)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00540  Lipopolysaccharide biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS019024.31820-T1-C
LinkDB
Position
C917413:1..267
AA seq 88 aa
PVVPIFASRKPEGGHIVHILPALHYEETGDEDVDMYRLTEACVRVTEEFIREHPDEWLWF
QHRWMTKMDQIIDYDKKIAIRERAHEKQ

KEGG   T30397 (Metagenome): 7446
Entry
7446              CDS       T30397                                 

Definition
hypothetical protein
  KO
K02517  Kdo2-lipid IVA lauroyltransferase/acyltransferase [EC:2.3.1.241 2.3.1.-]
Best hit
vpr:Vpar_0532 (best score: 93.2041)
Pathway
00540  Lipopolysaccharide biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS019024.7446-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_14346:complement(177..314)
AA seq 46 aa
DIAVTTTLLNEFIEDYIRRYPEDWFWLHNRWKWTRRFYGEXXXXXX

DBGET integrated database retrieval system