KEGG   T30397 (Metagenome): 23475
Entry
23475             CDS       T30397                                 

Definition
glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Best hit
ane:AN27039_2739 (best score: 112.464)
Taxonomy
Actinobacteria [GN:ane]
Pathway
00010  Glycolysis / Gluconeogenesis
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04066  HIF-1 signaling pathway
05010  Alzheimer disease
05130  Pathogenic Escherichia coli infection
05132  Salmonella infection
Other DBs
HMP: SRS019024.23475-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_26225:3..185
AA seq 61 aa
AAEGELKGVLKYTEDPIVSSDIVGDPHTSIFDATETKVIGNLVKVLSWYDNEWGYXXXXX
X

KEGG   T30397 (Metagenome): 13682
Entry
13682             CDS       T30397                                 

Gene name
gap
Definition
glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Best hit
ehl:EHLA_0909 (best score: 273.863)
Taxonomy
Firmicutes - Clostridia [GN:ehl]
Pathway
00010  Glycolysis / Gluconeogenesis
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04066  HIF-1 signaling pathway
05010  Alzheimer disease
05130  Pathogenic Escherichia coli infection
05132  Salmonella infection
Other DBs
HMP: SRS019024.13682-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_19178:193..669
AA seq 158 aa
XSTIHAYTGDQMILDGPQRKGDLRRSRAGACNIVPNSTGXLVIPELNGKLIGSAQRVPTP
TGSTTILVAVVKGKDVTVEGINAAMKAASTESFGYTEDQIVSSDIIGMRFGSLFDATQTM
VSKISDDCYQVQVVSWYDNENSYTSQMVRTIKYFAELK

KEGG   T30397 (Metagenome): 25991
Entry
25991             CDS       T30397                                 

Definition
glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate
dehydrogenase
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Best hit
rmu:RMDY18_00600 (best score: 248.825)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00010  Glycolysis / Gluconeogenesis
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04066  HIF-1 signaling pathway
05010  Alzheimer disease
05130  Pathogenic Escherichia coli infection
05132  Salmonella infection
Other DBs
HMP: SRS019024.25991-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_27953:3..392
AA seq 130 aa
GACSINIAALHKAHREAGSPELSMWLPEQLGSSVNHQGDQPKEQDVVLYGFGRIGRLLAR
ILLERSSSPLGSGLNLRAVVVRKNGDKDLVKRASLLERDSVHGPFKGVIEVDEENSTIIA
NGVPVRFIYS

KEGG   T30397 (Metagenome): 28888
Entry
28888             CDS       T30397                                 

Gene name
gap
Definition
glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Best hit
vpr:Vpar_1090 (best score: 209.149)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00010  Glycolysis / Gluconeogenesis
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04066  HIF-1 signaling pathway
05010  Alzheimer disease
05130  Pathogenic Escherichia coli infection
05132  Salmonella infection
Other DBs
HMP: SRS019024.28888-T1-C
LinkDB
Position
C908068:3..323
AA seq 107 aa
FAKVLCDEFGIKRGMMTTIHSYTNDQKILDARHKDPRRARAAAMSIIPTTTGAAKAVAKV
LPQLKGKLDGFALRVPTPDVSATDLVCELEKPATKEEINEAFRKAAA

KEGG   T30397 (Metagenome): 22351
Entry
22351             CDS       T30397                                 

Definition
hypothetical protein
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Best hit
adc:FOC79_01385 (best score: 39.6614)
Pathway
00010  Glycolysis / Gluconeogenesis
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04066  HIF-1 signaling pathway
05010  Alzheimer disease
05130  Pathogenic Escherichia coli infection
05132  Salmonella infection
Other DBs
HMP: SRS019024.22351-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_25445:complement(431..505)
AA seq 25 aa
NAAMKAASNESYGYTEDPXXXXXXX

KEGG   T30397 (Metagenome): 28142
Entry
28142             CDS       T30397                                 

Definition
hypothetical protein
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Best hit
vpr:Vpar_1090 (best score: 204.527)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00010  Glycolysis / Gluconeogenesis
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04066  HIF-1 signaling pathway
05010  Alzheimer disease
05130  Pathogenic Escherichia coli infection
05132  Salmonella infection
Other DBs
HMP: SRS019024.28142-T1-C
LinkDB
Position
C905404:2..298
AA seq 99 aa
KIRVFHDRDASKLPWSEEGVEIVMECTGKYRDAEEAKVHLNQPTVKKVLISAPGKNEDLT
MVMGVNQDMYDPAKHHIISNASCTTNCLAPFAKVLCDEF

KEGG   T30397 (Metagenome): 32430
Entry
32430             CDS       T30397                                 

Gene name
gap_1
Definition
glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Best hit
rmu:RMDY18_00600 (best score: 382.489)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00010  Glycolysis / Gluconeogenesis
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04066  HIF-1 signaling pathway
05010  Alzheimer disease
05130  Pathogenic Escherichia coli infection
05132  Salmonella infection
Other DBs
HMP: SRS019024.32430-T1-C
LinkDB
Position
C918939:complement(172..753)
AA seq 193 aa
SCTTNAITPALKVLDDTYGVERGHVETVHAFTNDQNLIDNFHKGDRRGRSAVLNMVITET
GAAKAVSKALPQLEGKLTGNAIRVPTPDVSMAILNVKLTKPAGSAEELNELFRRESIDGE
LRRQVGYSDSPEAVSTDFVGSRTAGVVDSLATVVTDDSAIVYVWYDNEFGYSCQVIRVLE
RMGGYDVPSYPAK

KEGG   T30397 (Metagenome): 22350
Entry
22350             CDS       T30397                                 

Definition
glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Best hit
stea:C0679_04805 (best score: 108.612)
Taxonomy
Firmicutes - Bacilli [GN:stea]
Pathway
00010  Glycolysis / Gluconeogenesis
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04066  HIF-1 signaling pathway
05010  Alzheimer disease
05130  Pathogenic Escherichia coli infection
05132  Salmonella infection
Other DBs
HMP: SRS019024.22350-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_25445:complement(173..358)
AA seq 61 aa
XXXVSSDILGMSYGSLFDATQTKVLDVDGKQLVKVVSWYDNEMSYTSQLVRTLEYFAKIA
K

KEGG   T30397 (Metagenome): 28416
Entry
28416             CDS       T30397                                 

Gene name
gap
Definition
glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Best hit
vpr:Vpar_1090 (best score: 155.992)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00010  Glycolysis / Gluconeogenesis
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04066  HIF-1 signaling pathway
05010  Alzheimer disease
05130  Pathogenic Escherichia coli infection
05132  Salmonella infection
Other DBs
HMP: SRS019024.28416-T1-C
LinkDB
Position
C906398:complement(75..308)
AA seq 77 aa
EAFRKAAAGELKGILGVSDVPLVSCDFSSDPRSSIVDADLTMVMDGNMVKVVSWYDNEWG
YSERLIDMAAFVASKGL

KEGG   T30397 (Metagenome): 27605
Entry
27605             CDS       T30397                                 

Definition
glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Best hit
rmu:RMDY18_11150 (best score: 334.339)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00010  Glycolysis / Gluconeogenesis
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04066  HIF-1 signaling pathway
05010  Alzheimer disease
05130  Pathogenic Escherichia coli infection
05132  Salmonella infection
Other DBs
HMP: SRS019024.27605-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_29011:363..878
AA seq 172 aa
XXXXLTDVETLAHLLKYDSIMGRFGAEVEVKEGALVVDGKEIKILAERDPQNLPWKDLGV
DVVLESTGFFTDGTKAKAHLEAGAKKVILSAPGKNIDGTFVMGVNDDQYDAANHHIVSNA
SCTTNCLAPMAKVLNDAFGIKQGLMTTIHAYTADQRLQDAPHRDLRRARAAA

KEGG   T30397 (Metagenome): 25370
Entry
25370             CDS       T30397                                 

Definition
glyceraldehyde-3-phosphate dehydrogenase, type I
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Best hit
rmu:RMDY18_11150 (best score: 71.6329)
Pathway
00010  Glycolysis / Gluconeogenesis
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04066  HIF-1 signaling pathway
05010  Alzheimer disease
05130  Pathogenic Escherichia coli infection
05132  Salmonella infection
Other DBs
HMP: SRS019024.25370-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_27524:3..107
AA seq 34 aa
KVIGDQVKVIAWYDNEYGYVSRLVMFTNKVVASL

DBGET integrated database retrieval system