KEGG   T30397 (Metagenome): 23570
Entry
23570             CDS       T30397                                 

Gene name
ppdK
Definition
pyruvate, phosphate dikinase
  KO
K01006  pyruvate, orthophosphate dikinase [EC:2.7.9.1]
Best hit
got:AXE85_06625 (best score: 158.303)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00010  Glycolysis / Gluconeogenesis
00620  Pyruvate metabolism
00710  Carbon fixation in photosynthetic organisms
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.23570-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_26289:1..345
AA seq 115 aa
IEFTIEDGKLYILQTRNAKRTPNAVVEVAVSLVEEGIITKEEAILRIGTEEINKLLXXXX
XXXXXXXLAASPGAAVGKIYFTAQEAVEAAKSHPVVLVREETSPEDIEGMVSSQG

KEGG   T30397 (Metagenome): 25443
Entry
25443             CDS       T30397                                 

Definition
pyruvate, phosphate dikinase
  KO
K01006  pyruvate, orthophosphate dikinase [EC:2.7.9.1]
Best hit
leo:AMK43_02040 (best score: 95.1301)
Pathway
00010  Glycolysis / Gluconeogenesis
00620  Pyruvate metabolism
00710  Carbon fixation in photosynthetic organisms
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.25443-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_27574:2..160
AA seq 52 aa
RKTNLKIGVCGEHGGDPKSIEFFEEQNLDYISCSPFRVPTAILAAAQAYLKK

KEGG   T30397 (Metagenome): 16262
Entry
16262             CDS       T30397                                 

Definition
pyruvate, phosphate dikinase
  KO
K01006  pyruvate, orthophosphate dikinase [EC:2.7.9.1]
Best hit
pdi:BDI_1031 (best score: 213.001)
Taxonomy
Bacteroidetes [GN:pdi]
Pathway
00010  Glycolysis / Gluconeogenesis
00620  Pyruvate metabolism
00710  Carbon fixation in photosynthetic organisms
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.16262-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_21051:complement(2..370)
AA seq 123 aa
VQAMVFGNMGESSATGVCFSRDAGTGENLFNGEYLINAQGEDVVAGIRTPQQITKEGSLR
WAAQQNIDEETRATKYPSMEEAMPELYKQLYALQDKLEKHYHDMQDMEFTVQEGKLWFLQ
TRN

KEGG   T30397 (Metagenome): 24249
Entry
24249             CDS       T30397                                 

Definition
pyruvate, phosphate dikinase
  KO
K01006  pyruvate, orthophosphate dikinase [EC:2.7.9.1]
Best hit
acq:AM609_11670 (best score: 94.3597)
Pathway
00010  Glycolysis / Gluconeogenesis
00620  Pyruvate metabolism
00710  Carbon fixation in photosynthetic organisms
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.24249-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_26761:complement(2..187)
AA seq 62 aa
XXXXRPENDPNQKGASMPRYVYRFSEGDKDQKDLLGGKGANLAEMTRLDLPVPPGFTITT
DA

KEGG   T30397 (Metagenome): 29762
Entry
29762             CDS       T30397                                 

Definition
pyruvate, phosphate dikinase
  KO
K01006  pyruvate, orthophosphate dikinase [EC:2.7.9.1]
Best hit
acq:AM609_11670 (best score: 207.223)
Taxonomy
Actinobacteria [GN:acq]
Pathway
00010  Glycolysis / Gluconeogenesis
00620  Pyruvate metabolism
00710  Carbon fixation in photosynthetic organisms
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.29762-T1-C
LinkDB
Position
C911021:2..361
AA seq 120 aa
VKGLAAASSDERFAWDSYRRLIQMFGKTVLDIDGDHFSDALDAKKDARGVSMDYELPVDA
LQELVEEYKAIVKEHAGIDFPQDPRSQLDMATEAVFRSWNTERARIYRRRERIPHDLGTA

KEGG   T30397 (Metagenome): 10825
Entry
10825             CDS       T30397                                 

Definition
pyruvate, phosphate dikinase
  KO
K01006  pyruvate, orthophosphate dikinase [EC:2.7.9.1]
Best hit
kfl:Kfla_2494 (best score: 52.373)
Pathway
00010  Glycolysis / Gluconeogenesis
00620  Pyruvate metabolism
00710  Carbon fixation in photosynthetic organisms
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.10825-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_17006:complement(1..93)
AA seq 31 aa
METGATRARKTKADMKLGVCGEHGGDPDSID

KEGG   T30397 (Metagenome): 847
Entry
847               CDS       T30397                                 

Definition
hypothetical protein
  KO
K01006  pyruvate, orthophosphate dikinase [EC:2.7.9.1]
Best hit
amy:ADJ76_06575 (best score: 115.931)
Taxonomy
Actinobacteria [GN:amy]
Pathway
00010  Glycolysis / Gluconeogenesis
00620  Pyruvate metabolism
00710  Carbon fixation in photosynthetic organisms
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.847-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_2407:216..401
AA seq 62 aa
XXXXYVYDFSEGDKSMKDLLGGKGANLAEMTKLGLPVPPGFTITTEACRAYLKESAVPET
LA

KEGG   T30397 (Metagenome): 6662
Entry
6662              CDS       T30397                                 

Definition
pyruvate, phosphate dikinase
  KO
K01006  pyruvate, orthophosphate dikinase [EC:2.7.9.1]
Best hit
buy:D8S85_08595 (best score: 69.3218)
Pathway
00010  Glycolysis / Gluconeogenesis
00620  Pyruvate metabolism
00710  Carbon fixation in photosynthetic organisms
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.6662-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_13699:232..357
AA seq 42 aa
XYLINAQGEDVVAGIRTPQQITKEGSLRWAAQQNIDEETRAA

DBGET integrated database retrieval system