KEGG   T30397 (Metagenome): 25139
Entry
25139             CDS       T30397                                 

Definition
hypothetical protein
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
Best hit
lla:L0010 spy:SPy_1881 (best score: 36.965)
Pathway
00010  Glycolysis / Gluconeogenesis
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04066  HIF-1 signaling pathway
Other DBs
HMP: SRS019024.25139-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_27373:complement(410..490)
AA seq 27 aa
ASMELLEGKVLPGLAALTEXXXXXXXX

KEGG   T30397 (Metagenome): 27311
Entry
27311             CDS       T30397                                 

Gene name
pgk
Definition
phosphoglycerate kinase
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
Best hit
rmu:RMDY18_11140 (best score: 348.977)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00010  Glycolysis / Gluconeogenesis
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04066  HIF-1 signaling pathway
Other DBs
HMP: SRS019024.27311-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_28822:3..548
AA seq 182 aa
PFVVVMGGAKVSDKLAVIDNLIGKADTILIGGGMGYTFAYAHGYEVGKSLLEKDQVENVL
RYLKEAPEKGTEIITAVDVVWADDFSADANTEIRPIEDLTGGKLGAEAEGLDIGPKTREI
FAEKIKGAKTIFWNGPVGVFEIAPFAEGTRAVAEAIVESDAFSIIGGGDSASAVRNLGFK
DE

KEGG   T30397 (Metagenome): 8720
Entry
8720              CDS       T30397                                 

Gene name
pgk
Definition
phosphoglycerate kinase
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
Best hit
ooi:A6A10_06690 pmu:PM1860 msu:MS0245 bto:WQG_7620 apag:EIA51_10340
hin:HI0525 (best score: 76.2553)
Pathway
00010  Glycolysis / Gluconeogenesis
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04066  HIF-1 signaling pathway
Other DBs
HMP: SRS019024.8720-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_15369:2..133
AA seq 44 aa
NKGEKKNDPELGKKYAALCDVFVMDAFGTAHRAQASXXXXXXXX

KEGG   T30397 (Metagenome): 14574
Entry
14574             CDS       T30397                                 

Gene name
pgk
Definition
phosphoglycerate kinase
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
Best hit
spy:SPy_1881 (best score: 82.4185)
Pathway
00010  Glycolysis / Gluconeogenesis
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04066  HIF-1 signaling pathway
Other DBs
HMP: SRS019024.14574-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_19818:complement(2..133)
AA seq 44 aa
XXXLPVDSKEANAFAGYTEVRDTEGEAVSEGFLGLDIGPKSIAK

KEGG   T30397 (Metagenome): 11238
Entry
11238             CDS       T30397                                 

Gene name
pgk
Definition
phosphoglycerate kinase
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
Best hit
ipo:Ilyop_0034 (best score: 78.5666)
Pathway
00010  Glycolysis / Gluconeogenesis
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04066  HIF-1 signaling pathway
Other DBs
HMP: SRS019024.11238-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_17326:complement(2..127)
AA seq 42 aa
XXXXNLKPGEVLMFENTRFEDLDGKKESKNDPELGKYWASLG

KEGG   T30397 (Metagenome): 8721
Entry
8721              CDS       T30397                                 

Gene name
pgk
Definition
phosphoglycerate kinase
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
Best hit
pmu:PM1860 rpne:NCTC8284_00768 hin:HI0525 aap:NT05HA_1724 (best
score: 83.1889)
Pathway
00010  Glycolysis / Gluconeogenesis
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04066  HIF-1 signaling pathway
Other DBs
HMP: SRS019024.8721-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_15369:205..336
AA seq 44 aa
XALKEPARPMVAIVGGSKVSTKLEVLNSLSKIADQIIVGGGIAN

KEGG   T30397 (Metagenome): 11239
Entry
11239             CDS       T30397                                 

Gene name
pgk
Definition
phosphoglycerate kinase
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
Best hit
fnu:FN0654 (best score: 59.3066)
Pathway
00010  Glycolysis / Gluconeogenesis
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04066  HIF-1 signaling pathway
Other DBs
HMP: SRS019024.11239-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_17326:complement(194..316)
AA seq 41 aa
GKVKTEEDKASKSLKAVAEKLSELLGKNVTFIPXXXXXXXX

KEGG   T30397 (Metagenome): 14575
Entry
14575             CDS       T30397                                 

Gene name
pgk
Definition
phosphoglycerate kinase
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
Best hit
spy:SPy_1881 (best score: 288.115)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00010  Glycolysis / Gluconeogenesis
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04066  HIF-1 signaling pathway
Other DBs
HMP: SRS019024.14575-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_19818:complement(183..656)
AA seq 158 aa
LVENTRYEDVDGKKESKNDPELGKYWASLGDGIFVNDAFGTAHRAHASNVGISANVEKAV
AGFLLENEIAYIQEAVEAPERPFVAILGGSKVSDKIGVIENLLEKADKVLIGGGMTYTFY
KAQGIEIGNSLVEEDKLDVAKALLEKANGKLXXXXXXX

KEGG   T30397 (Metagenome): 7997
Entry
7997              CDS       T30397                                 

Gene name
pgk
Definition
phosphoglycerate kinase
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
Best hit
bvs:BARVI_01915 (best score: 62.3882)
Pathway
00010  Glycolysis / Gluconeogenesis
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04066  HIF-1 signaling pathway
Other DBs
HMP: SRS019024.7997-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_14817:210..326
AA seq 39 aa
XXXMGKEVDAVNKVMQDIQRPFTAIMGGSKVSSKIDIIE

DBGET integrated database retrieval system