KEGG   T30397 (Metagenome): 2653
Entry
2653              CDS       T30397                                 

Gene name
trmB
Definition
bifunctional glycosyltransferase/methyltransferase
  KO
K02527  3-deoxy-D-manno-octulosonic-acid transferase [EC:2.4.99.12 2.4.99.13 2.4.99.14 2.4.99.15]
Best hit
fnu:FN1606 (best score: 114.39)
Taxonomy
Fusobacteria [GN:fnu]
Pathway
00540  Lipopolysaccharide biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS019024.2653-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_7068:194..373
AA seq 60 aa
XXXKYSDLENNTSTGKEDIILVDKMGVLRKLYSISDIAFVGGTLVNIGGHNLLEPLFYRK

KEGG   T30397 (Metagenome): 28031
Entry
28031             CDS       T30397                                 

Gene name
waaA
Definition
3-deoxy-D-manno-octulosonic-acid transferase
  KO
K02527  3-deoxy-D-manno-octulosonic-acid transferase [EC:2.4.99.12 2.4.99.13 2.4.99.14 2.4.99.15]
Best hit
vpr:Vpar_0540 (best score: 406.371)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00540  Lipopolysaccharide biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS019024.28031-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_29249:3..623
AA seq 207 aa
IYNVLLIFYWIGLIPVILYRLAFEDGFYERIKQSAGYMPASLLKKIEGRRAIWIHAASVG
EIVATSPLVKEVKKEFPEAVVVVSVVTATGHAMAHRIIPEAEGIIFFPLDLPYLTRKILH
IIKPITILLVETEIWPNFLRIAESENIPVMMVNGRISDRSMKRYKYISAFTREMLRSIER
FCMQSKFDAAYIESLGAHTPDITVTGN

KEGG   T30397 (Metagenome): 29488
Entry
29488             CDS       T30397                                 

Definition
three-deoxy-D-manno-octulosonic-acid transferase domain protein
  KO
K02527  3-deoxy-D-manno-octulosonic-acid transferase [EC:2.4.99.12 2.4.99.13 2.4.99.14 2.4.99.15]
Best hit
vpr:Vpar_0540 (best score: 187.193)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00540  Lipopolysaccharide biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS019024.29488-T1-C
LinkDB
Position
C910063:complement(73..348)
AA seq 91 aa
LEPAAHGKPILVGPHMFNFKEIFALLNSRNACEQVKNGKELTAMVLRLCKDRDLAKKMGQ
NCLDIIKENRGATRRNTQELRLLFEKHQIIP

KEGG   T30397 (Metagenome): 4246
Entry
4246              CDS       T30397                                 

Definition
hypothetical protein
  KO
K02527  3-deoxy-D-manno-octulosonic-acid transferase [EC:2.4.99.12 2.4.99.13 2.4.99.14 2.4.99.15]
Best hit
vpr:Vpar_0540 (best score: 68.1662)
Pathway
00540  Lipopolysaccharide biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS019024.4246-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_10492:3..116
AA seq 38 aa
FPLDLPYLTRKILHIIKPIAILLVETEIWPNFXXXXXX

KEGG   T30397 (Metagenome): 4247
Entry
4247              CDS       T30397                                 

Definition
hypothetical protein
  KO
K02527  3-deoxy-D-manno-octulosonic-acid transferase [EC:2.4.99.12 2.4.99.13 2.4.99.14 2.4.99.15]
Best hit
vpr:Vpar_0540 (best score: 72.0182)
Pathway
00540  Lipopolysaccharide biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS019024.4247-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_10492:206..322
AA seq 39 aa
XXXXLLEEFGFGNNHPIIIAGSTHKGEEETIFETFKQVL

DBGET integrated database retrieval system