KEGG   T30397 (Metagenome): 26652
Entry
26652             CDS       T30397                                 

Gene name
atoB
Definition
acetyl-coA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Best hit
euu:ADJ67_07405 (best score: 304.293)
Taxonomy
Firmicutes - Clostridia [GN:euu]
Pathway
00071  Fatty acid degradation
00072  Synthesis and degradation of ketone bodies
00280  Valine, leucine and isoleucine degradation
00310  Lysine degradation
00362  Benzoate degradation
00380  Tryptophan metabolism
00620  Pyruvate metabolism
00630  Glyoxylate and dicarboxylate metabolism
00640  Propanoate metabolism
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
00900  Terpenoid backbone biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
02020  Two-component system
04975  Fat digestion and absorption
Other DBs
HMP: SRS019024.26652-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_28394:complement(2..637)
AA seq 212 aa
VIMGNVLGAGLGQNVARQMSIHAGLPEFTPAFTINKVCGSGLKAVQLAAQAIQCGDADIV
VAGGAENMSQAPYVLPSFRWGGRMGDSKVVDTMIKDGLSDAFNEYHMGITAENVAEEYGI
SRDDQDALALESQKRAVAAIESGRFKEEIVPVVIPQRKGDPIVFDTDEFPRKDASLESLS
KLRPVFKKDGSVTAGNASGINDGAAAVLVMSA

KEGG   T30397 (Metagenome): 31394
Entry
31394             CDS       T30397                                 

Definition
acetyl-coA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Best hit
vpr:Vpar_0651 (best score: 224.557)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00071  Fatty acid degradation
00072  Synthesis and degradation of ketone bodies
00280  Valine, leucine and isoleucine degradation
00310  Lysine degradation
00362  Benzoate degradation
00380  Tryptophan metabolism
00620  Pyruvate metabolism
00630  Glyoxylate and dicarboxylate metabolism
00640  Propanoate metabolism
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
00900  Terpenoid backbone biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
02020  Two-component system
04975  Fat digestion and absorption
Other DBs
HMP: SRS019024.31394-T1-C
LinkDB
Position
C916221:complement(3..353)
AA seq 117 aa
MSVYIHGGLRSPIGVLNGQYKHMRPEILGSQVIDEIINRYSISHIDGIFCGNAVGTGGNL
GRLMGLMCNLPNYVPAITVDMQCASALMSIEIAYAHIVSGIMDSAIAGGIESSSLQP

KEGG   T30397 (Metagenome): 250
Entry
250               CDS       T30397                                 

Definition
hypothetical protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Best hit
vpr:Vpar_0651 (best score: 140.969)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00071  Fatty acid degradation
00072  Synthesis and degradation of ketone bodies
00280  Valine, leucine and isoleucine degradation
00310  Lysine degradation
00362  Benzoate degradation
00380  Tryptophan metabolism
00620  Pyruvate metabolism
00630  Glyoxylate and dicarboxylate metabolism
00640  Propanoate metabolism
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
00900  Terpenoid backbone biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
02020  Two-component system
04975  Fat digestion and absorption
Other DBs
HMP: SRS019024.250-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_687:169..387
AA seq 73 aa
XXXFSPEGALESTEAILKRTGLTMDDIDVVEWNEAFAIIDVLFNKAYPKHLEKYNKLGGA
LAYGHPYGCSGAI

KEGG   T30397 (Metagenome): 26232
Entry
26232             CDS       T30397                                 

Gene name
atoB
Definition
acetyl-coA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Best hit
nmk:CHR53_19260 (best score: 87.4261)
Pathway
00071  Fatty acid degradation
00072  Synthesis and degradation of ketone bodies
00280  Valine, leucine and isoleucine degradation
00310  Lysine degradation
00362  Benzoate degradation
00380  Tryptophan metabolism
00620  Pyruvate metabolism
00630  Glyoxylate and dicarboxylate metabolism
00640  Propanoate metabolism
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
00900  Terpenoid backbone biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
02020  Two-component system
04975  Fat digestion and absorption
Other DBs
HMP: SRS019024.26232-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_28116:425..607
AA seq 61 aa
MEVVMKDVVIVSAVRTPLGSFGGSLKNVSAVDLGSLVIKSALEKANIKPEQVDEVIMGNV
L

KEGG   T30397 (Metagenome): 27765
Entry
27765             CDS       T30397                                 

Definition
acetyl-coA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Best hit
vpr:Vpar_0651 (best score: 400.208)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00071  Fatty acid degradation
00072  Synthesis and degradation of ketone bodies
00280  Valine, leucine and isoleucine degradation
00310  Lysine degradation
00362  Benzoate degradation
00380  Tryptophan metabolism
00620  Pyruvate metabolism
00630  Glyoxylate and dicarboxylate metabolism
00640  Propanoate metabolism
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
00900  Terpenoid backbone biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
02020  Two-component system
04975  Fat digestion and absorption
Other DBs
HMP: SRS019024.27765-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_29098:complement(275..874)
AA seq 199 aa
GSHQRASAALDNPYLQSYIMPITIDGKRCIDECIRPTMNEKLLSRMKPLLGADSITNAGN
ACLTHDGAAFVYLSNKKGPFKIHSVKPWAGNPQFSPEGALESTEAILKRTGLTMDDIDVV
EWNEAFAIIDVLFDKTYPNHIGKYNMFGGALAYGHPYGCSGAILVLHCMAALESCGGRYG
LCAIAGAGGTGTALIMERM

KEGG   T30397 (Metagenome): 246
Entry
246               CDS       T30397                                 

Definition
thiolase, N-terminal domain
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Best hit
marr:BKP56_03625 (best score: 50.447)
Pathway
00071  Fatty acid degradation
00072  Synthesis and degradation of ketone bodies
00280  Valine, leucine and isoleucine degradation
00310  Lysine degradation
00362  Benzoate degradation
00380  Tryptophan metabolism
00620  Pyruvate metabolism
00630  Glyoxylate and dicarboxylate metabolism
00640  Propanoate metabolism
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
00900  Terpenoid backbone biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
02020  Two-component system
04975  Fat digestion and absorption
Other DBs
HMP: SRS019024.246-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_675:206..298
AA seq 31 aa
XXXXLTDAFGSFHMGITAENVAEQYGITRED

KEGG   T30397 (Metagenome): 245
Entry
245               CDS       T30397                                 

Definition
acetyl-coA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Best hit
spoa:EQM13_03240 (best score: 51.9878)
Pathway
00071  Fatty acid degradation
00072  Synthesis and degradation of ketone bodies
00280  Valine, leucine and isoleucine degradation
00310  Lysine degradation
00362  Benzoate degradation
00380  Tryptophan metabolism
00620  Pyruvate metabolism
00630  Glyoxylate and dicarboxylate metabolism
00640  Propanoate metabolism
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
00900  Terpenoid backbone biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
02020  Two-component system
04975  Fat digestion and absorption
Other DBs
HMP: SRS019024.245-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_675:3..116
AA seq 38 aa
LKAVQLAAQAVLCGDADIVVAGGAENMSQAPYXXXXXX

DBGET integrated database retrieval system