KEGG   T30397 (Metagenome): 26903
Entry
26903             CDS       T30397                                 

Gene name
lpxK
Definition
tetraacyldisaccharide-1-P 4'-kinase
  KO
K00912  tetraacyldisaccharide 4'-kinase [EC:2.7.1.130]
Best hit
vpr:Vpar_0541 (best score: 158.303)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00540  Lipopolysaccharide biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS019024.26903-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_28562:3..266
AA seq 88 aa
NIIISKDGTMLVEPSISGDEAWLLAKVLQKSNVIIGRERTKSAEIAINELGADCLIMDDG
FQHRALARDIDIVLIDASNPFXXXXXXX

KEGG   T30397 (Metagenome): 26904
Entry
26904             CDS       T30397                                 

Gene name
lpxK
Definition
tetraacyldisaccharide-1-P 4'-kinase
  KO
K00912  tetraacyldisaccharide 4'-kinase [EC:2.7.1.130]
Best hit
vpr:Vpar_0541 (best score: 240.736)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00540  Lipopolysaccharide biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS019024.26904-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_28562:377..721
AA seq 115 aa
MIPNIPVYETTHKPQFMYTLDEWANGSVGASVDAYKEQRIMAVSGIGNPQSFTQTLTDVG
YNVVHTLPFGDHHDFSNDDVVEIWKQAFAHQADAICITEKDAVKLSQLHAIEDLK

KEGG   T30397 (Metagenome): 29300
Entry
29300             CDS       T30397                                 

Gene name
lpxK
Definition
tetraacyldisaccharide-1-P 4'-kinase
  KO
K00912  tetraacyldisaccharide 4'-kinase [EC:2.7.1.130]
Best hit
vpr:Vpar_0541 (best score: 216.083)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00540  Lipopolysaccharide biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS019024.29300-T1-C
LinkDB
Position
C909415:complement(3..338)
AA seq 112 aa
SPMSGEALFKSIVSGEDQSVLGDIARSSLGLLSKGYEKAVSIRNARFDEGKGVTKVTVPV
ISVGNITAGGTGKTPMVRFICDVLTQKGLHPTVLSRGYRAEDNNKNIIISKD

DBGET integrated database retrieval system