KEGG   T30397 (Metagenome): 27198
Entry
27198             CDS       T30397                                 

Gene name
eno
Definition
phosphopyruvate hydratase
  KO
K01689  enolase [EC:4.2.1.11]
Best hit
vpr:Vpar_1086 (best score: 562.762)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00010  Glycolysis / Gluconeogenesis
00680  Methane metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
03018  RNA degradation
04066  HIF-1 signaling pathway
Other DBs
HMP: SRS019024.27198-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_28753:2..862
AA seq 287 aa
AAAESLDLPLFVYLGGFNAKELPVPMMNILNGGAHADNNVDIQEFMIMPVGAKSFAEALR
SCAEVYHTLKSVLHNKGLSTAVGDEGGFAPNLSSNEEALEVICEAIKAAGYEPGKDFKLA
LDSASSEFYEDGKYNLAGEGKVKTAAEMVDFYEYLVGKYPIVSIEDGLAEEDWEGWKLLT
ERLGDHVQLVGDDLFVTNTKRLARGIELGVGNSILVKVNQIGTLTEAFDAMELAKRAGYT
CVVSHRSGETEDTFIADIAVAVNAGQIKTGAPARSERVAKYNQLLRI

KEGG   T30397 (Metagenome): 13843
Entry
13843             CDS       T30397                                 

Gene name
eno
Definition
phosphopyruvate hydratase
  KO
K01689  enolase [EC:4.2.1.11]
Best hit
vpr:Vpar_1086 (best score: 87.0409)
Pathway
00010  Glycolysis / Gluconeogenesis
00680  Methane metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
03018  RNA degradation
04066  HIF-1 signaling pathway
Other DBs
HMP: SRS019024.13843-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_19291:332..463
AA seq 44 aa
MAVIEQVIAREILDSRGNPTVEVEVCLEDGTIATAAVPSGASTG

KEGG   T30397 (Metagenome): 9330
Entry
9330              CDS       T30397                                 

Gene name
eno
Definition
phosphopyruvate hydratase
  KO
K01689  enolase [EC:4.2.1.11]
Best hit
aql:BXU06_10970 (best score: 58.151)
Pathway
00010  Glycolysis / Gluconeogenesis
00680  Methane metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
03018  RNA degradation
04066  HIF-1 signaling pathway
Other DBs
HMP: SRS019024.9330-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_15845:216..311
AA seq 32 aa
XXXASTGENEALELRDGDKGRYLGKGVLKAVE

KEGG   T30397 (Metagenome): 28485
Entry
28485             CDS       T30397                                 

Gene name
eno
Definition
phosphopyruvate hydratase
  KO
K01689  enolase [EC:4.2.1.11]
Best hit
rmu:RMDY18_16380 (best score: 204.527)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00010  Glycolysis / Gluconeogenesis
00680  Methane metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
03018  RNA degradation
04066  HIF-1 signaling pathway
Other DBs
HMP: SRS019024.28485-T1-C
LinkDB
Position
C906666:complement(3..308)
AA seq 102 aa
ATGLGDEGGFAPNLESNAAALDLIVEAIEKAGYKPGEQVALALDVASSEFYNDGAYDFEG
QKKSAAEMSAYYADLVAKYPLVSIEDPLDENDWEGYKTLTEQ

KEGG   T30397 (Metagenome): 5891
Entry
5891              CDS       T30397                                 

Gene name
eno
Definition
enolase, C-terminal TIM barrel domain
  KO
K01689  enolase [EC:4.2.1.11]
Best hit
pru:PRU_1102 (best score: 64.6994)
Pathway
00010  Glycolysis / Gluconeogenesis
00680  Methane metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
03018  RNA degradation
04066  HIF-1 signaling pathway
Other DBs
HMP: SRS019024.5891-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_13012:complement(175..309)
AA seq 45 aa
GVKKDPEGKKLTAEEQINYLEQLITEYPIDSIEDGLDXXXXXXXX

KEGG   T30397 (Metagenome): 17404
Entry
17404             CDS       T30397                                 

Gene name
eno
Definition
enolase, C-terminal TIM barrel domain
  KO
K01689  enolase [EC:4.2.1.11]
Best hit
acq:AM609_11235 (best score: 206.068)
Taxonomy
Actinobacteria [GN:acq]
Pathway
00010  Glycolysis / Gluconeogenesis
00680  Methane metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
03018  RNA degradation
04066  HIF-1 signaling pathway
Other DBs
HMP: SRS019024.17404-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_21895:complement(3..344)
AA seq 114 aa
EGGFAPNLDSNREALELIVEAIEKAGYKPGKDVALAMDVASSEFFDEKTKTYQFEGEARD
NAFMVDYYEKLITDFPIVSIEDPLSEDEWDDWKALTDKIGDRVQLVGDDFFVTN

KEGG   T30397 (Metagenome): 23005
Entry
23005             CDS       T30397                                 

Gene name
eno
Definition
phosphopyruvate hydratase
  KO
K01689  enolase [EC:4.2.1.11]
Best hit
orh:Ornrh_0446 (best score: 104.375)
Taxonomy
Bacteroidetes [GN:orh]
Pathway
00010  Glycolysis / Gluconeogenesis
00680  Methane metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
03018  RNA degradation
04066  HIF-1 signaling pathway
Other DBs
HMP: SRS019024.23005-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_25890:complement(2..172)
AA seq 57 aa
XXXMDENDWEGWKLLTDRIGDRVQLVGDDLFVTNTEILSRGIAQGIANSILIKVNQI

KEGG   T30397 (Metagenome): 21405
Entry
21405             CDS       T30397                                 

Gene name
eno
Definition
phosphopyruvate hydratase
  KO
K01689  enolase [EC:4.2.1.11]
Best hit
sox:TM7x_01645 (best score: 169.474)
Taxonomy
Saccharibacteria [GN:sox]
Pathway
00010  Glycolysis / Gluconeogenesis
00680  Methane metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
03018  RNA degradation
04066  HIF-1 signaling pathway
Other DBs
HMP: SRS019024.21405-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_24765:complement(1..321)
AA seq 107 aa
VSLAVAKAAAKSRGVELYQYVNSLAGNPTMCLPMPMINVMNGGQHXXXXXXXXXXXAVRM
SAEVFHALAKILKDEGYPTTVGDEGGYAPHVRNGNMEPILLLSRAIE

KEGG   T30397 (Metagenome): 3414
Entry
3414              CDS       T30397                                 

Gene name
eno
Definition
phosphopyruvate hydratase
  KO
K01689  enolase [EC:4.2.1.11]
Best hit
fnu:FN1764 (best score: 64.3142)
Pathway
00010  Glycolysis / Gluconeogenesis
00680  Methane metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
03018  RNA degradation
04066  HIF-1 signaling pathway
Other DBs
HMP: SRS019024.3414-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_8770:complement(320..433)
AA seq 38 aa
RGRAAVPSGASTGSHEAVELRDEDKSRYLGKGXXXXXX

KEGG   T30397 (Metagenome): 3290
Entry
3290              CDS       T30397                                 

Gene name
eno
Definition
phosphopyruvate hydratase
  KO
K01689  enolase [EC:4.2.1.11]
Best hit
eke:EK0264_14005 (best score: 173.326)
Taxonomy
Actinobacteria [GN:eke]
Pathway
00010  Glycolysis / Gluconeogenesis
00680  Methane metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
03018  RNA degradation
04066  HIF-1 signaling pathway
Other DBs
HMP: SRS019024.3290-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_8568:complement(1..429)
AA seq 143 aa
AVPSGASTGAGEALELRDGGSQWTGKGVSQAVAHVNDVIAPALVGHDASDQRAIDNAMLA
LDGTDNKSKLGANAILSVSLATAKAVAHAKQQPLWRYIAEQTGSTPSLPLPMMNVLNGGA
HAAFATDIQEFMIICKGAATFAD

KEGG   T30397 (Metagenome): 23006
Entry
23006             CDS       T30397                                 

Gene name
eno
Definition
phosphopyruvate hydratase
  KO
K01689  enolase [EC:4.2.1.11]
Best hit
got:AXE85_01825 (best score: 93.5893)
Pathway
00010  Glycolysis / Gluconeogenesis
00680  Methane metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
03018  RNA degradation
04066  HIF-1 signaling pathway
Other DBs
HMP: SRS019024.23006-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_25890:complement(263..430)
AA seq 56 aa
IAFQEFMILPVGAPTFKEALRWGAEVFHNLAKLLHNRGLSTAVGDEGGXXXXXXXX

KEGG   T30397 (Metagenome): 3413
Entry
3413              CDS       T30397                                 

Gene name
eno
Definition
phosphopyruvate hydratase
  KO
K01689  enolase [EC:4.2.1.11]
Best hit
fnu:FN1764 (best score: 146.362)
Taxonomy
Fusobacteria [GN:fnu]
Pathway
00010  Glycolysis / Gluconeogenesis
00680  Methane metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
03018  RNA degradation
04066  HIF-1 signaling pathway
Other DBs
HMP: SRS019024.3413-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_8770:complement(2..256)
AA seq 85 aa
XXXGRLGANAILGVSLAVAKAAAEALGQPLYKYLGGVNAKELPLPMMNILNGGAHADSAV
DLQEFMIQPVGAKSFQEAMRMGAEI

KEGG   T30397 (Metagenome): 31364
Entry
31364             CDS       T30397                                 

Gene name
eno
Definition
phosphopyruvate hydratase
  KO
K01689  enolase [EC:4.2.1.11]
Best hit
spy:SPy_0731 (best score: 294.664)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00010  Glycolysis / Gluconeogenesis
00680  Methane metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
03018  RNA degradation
04066  HIF-1 signaling pathway
Other DBs
HMP: SRS019024.31364-T1-C
LinkDB
Position
C916135:41..496
AA seq 152 aa
MSIITDVYAREVLDSRGNPTLEVEVYTESGAFGRGMVPSGASTGEHEAVELRDGDKSRYG
GLGTQKAVDNVNNIIAEAIIGYDVRDQQAIDRAMIALDGTPNKGKLGANAILGVSIAVAR
AAADYLEIPLYSYLGGFNTKVLPTPMMNIING

KEGG   T30397 (Metagenome): 17109
Entry
17109             CDS       T30397                                 

Gene name
eno
Definition
phosphopyruvate hydratase
  KO
K01689  enolase [EC:4.2.1.11]
Best hit
rmu:RMDY18_16380 (best score: 84.3445)
Pathway
00010  Glycolysis / Gluconeogenesis
00680  Methane metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
03018  RNA degradation
04066  HIF-1 signaling pathway
Other DBs
HMP: SRS019024.17109-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_21675:842..988
AA seq 49 aa
MAVITAVHARQILDSRGNPTVEVEVLLEDGAFARAAVPSGASTXXXXXX

DBGET integrated database retrieval system