KEGG   T30397 (Metagenome): 27592
Entry
27592             CDS       T30397                                 

Gene name
ackA
Definition
acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Best hit
vte:BHY08_09050 (best score: 157.147)
Taxonomy
Firmicutes - Bacilli [GN:vte]
Pathway
00430  Taurine and hypotaurine metabolism
00620  Pyruvate metabolism
00640  Propanoate metabolism
00680  Methane metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.27592-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_29003:3..332
AA seq 110 aa
SKSIAINAGSSSLKFQLFNMPQEEVVAKGLVERIGLGDSIFSISYGDDQKFEVVEDIPNH
EVAVEKLLEQLVALNIISSFDEITGVGHRVVAGGELFKDSALVDXXXXXX

KEGG   T30397 (Metagenome): 23190
Entry
23190             CDS       T30397                                 

Gene name
ackA
Definition
acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Best hit
abae:CL176_04885 thl:TEH_02440 (best score: 98.2117)
Pathway
00430  Taurine and hypotaurine metabolism
00620  Pyruvate metabolism
00640  Propanoate metabolism
00680  Methane metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.23190-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_26020:complement(2..169)
AA seq 56 aa
XILGRPLEDLKLITCHIGNGASITAVSGGKSVDTSMGFTPLGGIMMGTRTGDIDPA

KEGG   T30397 (Metagenome): 482
Entry
482               CDS       T30397                                 

Gene name
ackA
Definition
acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Best hit
spy:SPy_0109 (best score: 53.1434)
Pathway
00430  Taurine and hypotaurine metabolism
00620  Pyruvate metabolism
00640  Propanoate metabolism
00680  Methane metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.482-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_1382:complement(199..300)
AA seq 34 aa
NKVRKYGAHGTSHQFVAQEAAKLLGRPLXXXXXX

KEGG   T30397 (Metagenome): 22585
Entry
22585             CDS       T30397                                 

Gene name
ackA
Definition
acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Best hit
mps:MPTP_1387 (best score: 86.6557)
Pathway
00430  Taurine and hypotaurine metabolism
00620  Pyruvate metabolism
00640  Propanoate metabolism
00680  Methane metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.22585-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_25604:complement(2..169)
AA seq 56 aa
XXXFDIIKSYDEITGVGHRVVAGGEYFKDSALVDDEVLRKVEELSLLAPLHNPANA

KEGG   T30397 (Metagenome): 24192
Entry
24192             CDS       T30397                                 

Gene name
ackA
Definition
acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Best hit
vpr:Vpar_1231 (best score: 127.102)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00430  Taurine and hypotaurine metabolism
00620  Pyruvate metabolism
00640  Propanoate metabolism
00680  Methane metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.24192-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_26728:1535..1738
AA seq 68 aa
MNVLVVNCGSSSLKYQLLDMTTETELAKGLFEKIGDQDAIFTHKRPNADKLERVEPILNH
KEXXXXXX

KEGG   T30397 (Metagenome): 19170
Entry
19170             CDS       T30397                                 

Gene name
ackA
Definition
acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Best hit
rmu:RMDY18_01260 (best score: 95.9005)
Pathway
00430  Taurine and hypotaurine metabolism
00620  Pyruvate metabolism
00640  Propanoate metabolism
00680  Methane metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.19170-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_23158:1..159
AA seq 53 aa
MLGIARDEFNGIVAHLGNGASVTAVKGGKSVDTSMGYTPLAGLIMGTXXXXXX

KEGG   T30397 (Metagenome): 3724
Entry
3724              CDS       T30397                                 

Gene name
ackA
Definition
acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Best hit
fnu:FN1171 (best score: 212.616)
Taxonomy
Fusobacteria [GN:fnu]
Pathway
00430  Taurine and hypotaurine metabolism
00620  Pyruvate metabolism
00640  Propanoate metabolism
00680  Methane metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.3724-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_9394:complement(2..331)
AA seq 110 aa
GLTDAQMDDRMNKKSGILGLFGKSSDCRDMENAVKEGDERAILAESVSMHRLRSYIGAYA
AVMGGVDAICFTGGIGENSSMTRKKALEGLEFLGVELDKEINSVRKKGNV

KEGG   T30397 (Metagenome): 8889
Entry
8889              CDS       T30397                                 

Gene name
ackA
Definition
acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Best hit
spy:SPy_0109 (best score: 84.3445)
Pathway
00430  Taurine and hypotaurine metabolism
00620  Pyruvate metabolism
00640  Propanoate metabolism
00680  Methane metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.8889-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_15506:complement(198..362)
AA seq 55 aa
AYRYPLPTKYYTENKVRKYGAHGTSHEYVAHEAAKLLGKPIEELKLITCXXXXXX

KEGG   T30397 (Metagenome): 22157
Entry
22157             CDS       T30397                                 

Gene name
ackA
Definition
acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Best hit
lla:L73818 (best score: 80.1073)
Pathway
00430  Taurine and hypotaurine metabolism
00620  Pyruvate metabolism
00640  Propanoate metabolism
00680  Methane metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.22157-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_25305:complement(1..162)
AA seq 54 aa
XKEGDHDATLAYEIYIDRIQKHIGQYLAVLNGADAIIFTAGVGENATDVREDVI

KEGG   T30397 (Metagenome): 14134
Entry
14134             CDS       T30397                                 

Gene name
ackA
Definition
acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Best hit
vpr:Vpar_1231 (best score: 93.2041)
Pathway
00430  Taurine and hypotaurine metabolism
00620  Pyruvate metabolism
00640  Propanoate metabolism
00680  Methane metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.14134-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_19511:2..145
AA seq 48 aa
VFDTAFHQTMPKEAYMYALPYEYYEDYGIRRYGFHGTSHKYXXXXXXX

KEGG   T30397 (Metagenome): 23191
Entry
23191             CDS       T30397                                 

Definition
hypothetical protein
  KO
K00925  acetate kinase [EC:2.7.2.1]
Best hit
spy:SPy_0109 (best score: 39.2762)
Pathway
00430  Taurine and hypotaurine metabolism
00620  Pyruvate metabolism
00640  Propanoate metabolism
00680  Methane metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.23191-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_26020:complement(235..318)
AA seq 28 aa
PNKYYTENKVRKYGAHGTSHXXXXXXXX

KEGG   T30397 (Metagenome): 30668
Entry
30668             CDS       T30397                                 

Definition
hypothetical protein
  KO
K00925  acetate kinase [EC:2.7.2.1]
Best hit
vpr:Vpar_1231 (best score: 39.2762)
Pathway
00430  Taurine and hypotaurine metabolism
00620  Pyruvate metabolism
00640  Propanoate metabolism
00680  Methane metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.30668-T1-C
LinkDB
Position
C913951:3..62
AA seq 19 aa
NEEIMIARDTQRITAALKK

KEGG   T30397 (Metagenome): 27192
Entry
27192             CDS       T30397                                 

Gene name
ackA
Definition
acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Best hit
rmu:RMDY18_01260 (best score: 152.91)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00430  Taurine and hypotaurine metabolism
00620  Pyruvate metabolism
00640  Propanoate metabolism
00680  Methane metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.27192-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_28748:complement(25..279)
AA seq 84 aa
XXXXGGAQALIFTAGIGENSGDFRKLVLDRLGPLGIKYNEEENAKRSPEPRVISTEDSAI
KVLVIPTNEEKAIAEATEELVKSL

KEGG   T30397 (Metagenome): 24193
Entry
24193             CDS       T30397                                 

Gene name
ackA
Definition
acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Best hit
vpr:Vpar_1231 (best score: 327.405)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00430  Taurine and hypotaurine metabolism
00620  Pyruvate metabolism
00640  Propanoate metabolism
00680  Methane metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.24193-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_26728:1790..2284
AA seq 165 aa
XXXXLRILLDILVDAEFGVISSMDEIDAVGHRVVHGGEKFADSVLITPAVMEALEECASL
APLHNPPNIQGIEACEAIMPNVPQVAVFDTAFHQTMPKEAYMYALPYSYYEDYGIRRYGF
HGTSHKYVAQRCAELMGKHMTDLRIITCHLGNGSSVAAIKGGRSI

KEGG   T30397 (Metagenome): 19171
Entry
19171             CDS       T30397                                 

Gene name
ackA
Definition
acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Best hit
rmu:RMDY18_01260 (best score: 87.0409)
Pathway
00430  Taurine and hypotaurine metabolism
00620  Pyruvate metabolism
00640  Propanoate metabolism
00680  Methane metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.19171-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_23158:270..404
AA seq 45 aa
XESGLLALAGSNDMRKVVEAAQSGDERAQLALDMTSYRLMKYIGG

KEGG   T30397 (Metagenome): 8888
Entry
8888              CDS       T30397                                 

Gene name
ackA
Definition
acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Best hit
lla:L0224 (best score: 40.4318)
Pathway
00430  Taurine and hypotaurine metabolism
00620  Pyruvate metabolism
00640  Propanoate metabolism
00680  Methane metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.8888-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_15506:complement(2..112)
AA seq 37 aa
XIPYLMQHTDDFKTPEDISRILNRESGLLGVSEKSSD

KEGG   T30397 (Metagenome): 481
Entry
481               CDS       T30397                                 

Gene name
ackA
Definition
acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Best hit
spy:SPy_0109 (best score: 45.4394)
Pathway
00430  Taurine and hypotaurine metabolism
00620  Pyruvate metabolism
00640  Propanoate metabolism
00680  Methane metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.481-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_1382:complement(1..111)
AA seq 37 aa
XXXXVMMGTRTGDIDPAIIPYLMEHTNDFNTPEDIIN

KEGG   T30397 (Metagenome): 31152
Entry
31152             CDS       T30397                                 

Gene name
ackA
Definition
acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Best hit
rmu:RMDY18_01260 (best score: 162.54)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00430  Taurine and hypotaurine metabolism
00620  Pyruvate metabolism
00640  Propanoate metabolism
00680  Methane metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.31152-T1-C
LinkDB
Position
C915479:95..466
AA seq 124 aa
MLAERNWRAPNCVPFEYFLQAPTKPARAAPAEVRRKTLHPLSRTYARKVREWSEKENYER
DTFMLILVVNAGSSSLKYQVRDTSLPEAEQMLTSGLVENIGTDVPNHEVAFDIMSEKLEP
VLAG

KEGG   T30397 (Metagenome): 7655
Entry
7655              CDS       T30397                                 

Gene name
ackA
Definition
acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Best hit
fnu:FN1171 (best score: 69.707)
Pathway
00430  Taurine and hypotaurine metabolism
00620  Pyruvate metabolism
00640  Propanoate metabolism
00680  Methane metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.7655-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_14524:1..126
AA seq 42 aa
SVRKKGNVKLSKDSSKVLVYKIPTNEELVIARDTFXXXXXXX

DBGET integrated database retrieval system