KEGG   T30397 (Metagenome): 27933
Entry
27933             CDS       T30397                                 

Definition
phosphoenolpyruvate carboxykinase (ATP)-like protein
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Best hit
vpr:Vpar_0207 (best score: 238.424)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.27933-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_29191:1..438
AA seq 146 aa
YNITFTREITNIFKGEDLDTMSTRRVWKQSEIKTNPLFSMMRSTIETAFYGNNVTPVTSV
AQAYQLASEEPGVIVLDMPVFKPLEQGLPADAKVLVTNDGKTTGRYAKARRIIGDEGIDE
VELANIARDAVYDSRNKEWXXXXXXX

KEGG   T30397 (Metagenome): 28543
Entry
28543             CDS       T30397                                 

Gene name
pckA
Definition
phosphoenolpyruvate carboxykinase [ATP]
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Best hit
fnu:FN1120 (best score: 115.161)
Taxonomy
Fusobacteria [GN:fnu]
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.28543-T1-C
LinkDB
Position
C906856:2..172
AA seq 56 aa
CPNVPSEIMNPIDTWEDKEQYIIAAKKLANLFYKNFKEKYPNMPENITNAGPKYND

KEGG   T30397 (Metagenome): 16395
Entry
16395             CDS       T30397                                 

Definition
phosphoenolpyruvate carboxykinase (ATP)-like protein
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Best hit
vpr:Vpar_0207 (best score: 93.2041)
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.16395-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_21154:complement(2..139)
AA seq 46 aa
XXXMKRYNLEGGKTYTIGVFGLSGSGKSTLTHEKHGGRYDISILHD

KEGG   T30397 (Metagenome): 20303
Entry
20303             CDS       T30397                                 

Gene name
pckA
Definition
phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Best hit
aap:NT05HA_1606 (best score: 196.052)
Taxonomy
Gammaproteobacteria - Others [GN:aap]
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.20303-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_23994:3..299
AA seq 99 aa
VMNGSKCTNPNWKEQGLNSENFVAFNLTERIQLIGGTWYGGEMKKGMFSMMNYFLPLKGV
GAMHCSANVGKDGDVAIFFGLSGTGKTTLSTDPKRQLIG

KEGG   T30397 (Metagenome): 28775
Entry
28775             CDS       T30397                                 

Gene name
pckA
Definition
phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Best hit
aap:NT05HA_1606 (best score: 206.838)
Taxonomy
Gammaproteobacteria - Others [GN:aap]
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.28775-T1-C
LinkDB
Position
C907646:1..318
AA seq 106 aa
KNVIKELEAVGIHDVKEVVYNPSYEQLFEEETKPGLEGFEKGTLTTTGAVAVDTGIFTGR
SPKDKYIVLDDTTKDTVWWTSDVAKNDNKPMTQETWSSLKGLVTKQ

KEGG   T30397 (Metagenome): 26748
Entry
26748             CDS       T30397                                 

Definition
phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Best hit
vpr:Vpar_0207 (best score: 246.128)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.26748-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_28458:3..359
AA seq 118 aa
RTYPLVRDYESYKKLFSKCGVECYIMNTGFFLENKIPKEVTLDLLERLVEGTLEFKPFCE
YENLSYVEVPGFEPPFEVREYHHQLHQAFEFRYDYVEKLKGHKNELPQEVLDVLKSLM

KEGG   T30397 (Metagenome): 6841
Entry
6841              CDS       T30397                                 

Gene name
pckA
Definition
phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Best hit
cpaf:C6V80_00430 (best score: 77.7962)
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.6841-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_13858:complement(3..107)
AA seq 35 aa
XTTLSTDPKRKLIGDDEHGWDDKGIFNYEGGCYAK

KEGG   T30397 (Metagenome): 16396
Entry
16396             CDS       T30397                                 

Definition
phosphoenolpyruvate carboxykinase (ATP)-like protein
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Best hit
vpr:Vpar_0207 (best score: 325.865)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.16396-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_21154:complement(193..687)
AA seq 165 aa
KPLEQGLPADAKVLVTNDGKTTGRYAKARRIIGDEGIDEVELANIARDAVYDSRNKEWIS
AESIVGLDKKFTARAHLMIPKDHASILYSWLMNFKFFDAAVKEFYNDSVDIPEGDIYIYS
DPDYVVPGHPGGLAIFDPAHNCAMILGMRYFGEHKKGTXXXXXXX

KEGG   T30397 (Metagenome): 6842
Entry
6842              CDS       T30397                                 

Gene name
pckA
Definition
phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Best hit
alq:C7Y71_008015 (best score: 95.1301)
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.6842-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_13858:complement(143..334)
AA seq 64 aa
TNMFIRPKSEADFDQEPDFIVYNASKAKVENWKELGLHSETCVMFNVTTKEQVIVNTXXX
XXXX

DBGET integrated database retrieval system