KEGG   T30397 (Metagenome): 28108
Entry
28108             CDS       T30397                                 

Gene name
mqo
Definition
probable malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Best hit
rmu:RMDY18_07450 (best score: 159.844)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.28108-T1-C
LinkDB
Position
C905280:3..254
AA seq 83 aa
QFGTEVVSAADGSIAALLGASPGASTAAPIMLNLLSKCFPSKIAGWEPRLKELIPGYGVK
LNDNPQLADELMGHTAKVLGIHN

KEGG   T30397 (Metagenome): 11531
Entry
11531             CDS       T30397                                 

Gene name
mqo
Definition
probable malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Best hit
rmu:RMDY18_07450 (best score: 58.9214)
Pathway
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.11531-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_17547:complement(681..803)
AA seq 41 aa
XXXFWASLVEEKILPNTEFINPVPHMSLVFGEDXXXXXXXX

KEGG   T30397 (Metagenome): 11530
Entry
11530             CDS       T30397                                 

Gene name
mqo
Definition
probable malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Best hit
rmu:RMDY18_07450 (best score: 382.104)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.11530-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_17547:complement(3..608)
AA seq 202 aa
XXXXKLFERMEFSTEREKIAEWAPLTVNGRKGNEPIAATWAPEGTDVDFGALTQHMIDYL
QSKGVEVRYGYQVTNLNRESNGSWTVDAINRINKEEPLTINAKFVFLGAGGGALHLLQKS
GIKEGKGYGGFPVSGLFLRNTHEATAQKHNAKVYGQASVGAPPMSVPHLDTRYVDGKRAL
MFGPYAGFKTNFLKQGSLLDLP

KEGG   T30397 (Metagenome): 11532
Entry
11532             CDS       T30397                                 

Definition
hypothetical protein
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Best hit
rmu:RMDY18_07450 (best score: 47.3654)
Pathway
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.11532-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_17547:complement(904..993)
AA seq 30 aa
LDKAAQESTNPWNNAGTGHSALXXXXXXXX

DBGET integrated database retrieval system