KEGG   T30397 (Metagenome): 29173
Entry
29173             CDS       T30397                                 

Definition
phosphotransferase system lactose/cellobiose-specific IIB subunit
  KO
K02822  ascorbate PTS system EIIB component [EC:2.7.1.194]
Best hit
vpr:Vpar_1347 (best score: 94.7449)
Pathway
00053  Ascorbate and aldarate metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
02060  Phosphotransferase system (PTS)
Other DBs
HMP: SRS019024.29173-T1-C
LinkDB
Position
C909019:192..332
AA seq 47 aa
MISVLTVCGNGIGSSLMLKMKIEEICAENGIDAQVESIDFNAAQGRK

KEGG   T30397 (Metagenome): 32622
Entry
32622             CDS       T30397                                 

Definition
PTS system, IIB component, putative
  KO
K02822  ascorbate PTS system EIIB component [EC:2.7.1.194]
Best hit
stk:STP_1775 (best score: 108.997)
Taxonomy
Firmicutes - Bacilli [GN:stk]
Pathway
00053  Ascorbate and aldarate metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
02060  Phosphotransferase system (PTS)
Other DBs
HMP: SRS019024.32622-T1-C
LinkDB
Position
C919304:complement(1..171)
AA seq 57 aa
MLKIGTACGSGLGSSFMVQMNIESVLSDLNVSDVEVEHYDLGGADPNAADIWIVGRD

KEGG   T30397 (Metagenome): 4191
Entry
4191              CDS       T30397                                 

Definition
phosphotransferase system sugar-specific EII component
  KO
K02822  ascorbate PTS system EIIB component [EC:2.7.1.194]
Best hit
spy:SPy_0175 (best score: 48.521)
Pathway
00053  Ascorbate and aldarate metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
02060  Phosphotransferase system (PTS)
Other DBs
HMP: SRS019024.4191-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_10394:complement(196..318)
AA seq 41 aa
SMVIKMKVENALRKLNQTDFTVNSCSVGEAKSLAAXXXXXX

DBGET integrated database retrieval system