KEGG   T30397 (Metagenome): 29324
Entry
29324             CDS       T30397                                 

Gene name
dapF
Definition
diaminopimelate epimerase
  KO
K01778  diaminopimelate epimerase [EC:5.1.1.7]
Best hit
vpr:Vpar_1575 (best score: 58.5362)
Pathway
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.29324-T1-C
LinkDB
Position
C909481:complement(257..340)
AA seq 27 aa
HISYLEDGTVLMTGPAEEVFETELPID

KEGG   T30397 (Metagenome): 29531
Entry
29531             CDS       T30397                                 

Gene name
dapF
Definition
diaminopimelate epimerase
  KO
K01778  diaminopimelate epimerase [EC:5.1.1.7]
Best hit
rmu:RMDY18_14460 (best score: 233.032)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.29531-T1-C
LinkDB
Position
C910219:complement(3..350)
AA seq 116 aa
WFMDYRNGDGSIAEMCGNGVRAFVDYLRTEGLIELEVGQTVQIATRAGVKTVARTEEGYA
VDMGPWSFIHGDAAREGGEDCLVSARGLKTPRAGLSISMGNPHTVVMLGSEGKLDG

KEGG   T30397 (Metagenome): 29673
Entry
29673             CDS       T30397                                 

Gene name
dapF
Definition
diaminopimelate epimerase
  KO
K01778  diaminopimelate epimerase [EC:5.1.1.7]
Best hit
vpr:Vpar_1575 (best score: 236.498)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.29673-T1-C
LinkDB
Position
C910677:complement(2..355)
AA seq 118 aa
DVDLNVNGETVTVSSVLLGVPHTEVFIDDITKAPVTTQGPILEKHDAFPANTNVNYIEVV
NDKHIKVRTWERGAGATLACGTGSCASAAMSFEKGLTGREVDVELYLGTLHISYLEDG

KEGG   T30397 (Metagenome): 3071
Entry
3071              CDS       T30397                                 

Definition
hypothetical protein
  KO
K01778  diaminopimelate epimerase [EC:5.1.1.7]
Best hit
pru:PRU_1958 (best score: 53.9138)
Pathway
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.3071-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_8050:complement(1..111)
AA seq 37 aa
XXXXTLKYDIPHPSVASIAWSNRHMGIGSDGLVLIGK

KEGG   T30397 (Metagenome): 4111
Entry
4111              CDS       T30397                                 

Gene name
dapF
Definition
diaminopimelate epimerase
  KO
K01778  diaminopimelate epimerase [EC:5.1.1.7]
Best hit
alq:C7Y71_010615 (best score: 47.3654)
Pathway
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.4111-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_10246:complement(13..111)
AA seq 32 aa
XXXXIEWKDDNHIYMTGPAAFAFEGEVELPEG

KEGG   T30397 (Metagenome): 4112
Entry
4112              CDS       T30397                                 

Gene name
dapF
Definition
diaminopimelate epimerase
  KO
K01778  diaminopimelate epimerase [EC:5.1.1.7]
Best hit
tom:BWR18_16035 (best score: 60.4622)
Pathway
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.4112-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_10246:complement(173..388)
AA seq 72 aa
FVVFLDQSKIDDTKQLITDTDLTVIGKALEHDSAFPERCNIEFACLTGANHLRTRVWERG
SGITXXXXXXXX

KEGG   T30397 (Metagenome): 9952
Entry
9952              CDS       T30397                                 

Gene name
dapF
Definition
diaminopimelate epimerase
  KO
K01778  diaminopimelate epimerase [EC:5.1.1.7]
Best hit
rmu:RMDY18_14460 (best score: 77.4109)
Pathway
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.9952-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_16346:complement(216..371)
AA seq 52 aa
EGKLDGLDLYSQPQVNPAPADGTNVEFVVPVDLENDGSTHVGAIRMXXXXXX

DBGET integrated database retrieval system