KEGG   T30397 (Metagenome): 29370
Entry
29370             CDS       T30397                                 

Definition
aldehyde dehydrogenase (NAD) family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Best hit
vpr:Vpar_1382 (best score: 216.468)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00010  Glycolysis / Gluconeogenesis
00053  Ascorbate and aldarate metabolism
00071  Fatty acid degradation
00280  Valine, leucine and isoleucine degradation
00310  Lysine degradation
00330  Arginine and proline metabolism
00340  Histidine metabolism
00380  Tryptophan metabolism
00410  beta-Alanine metabolism
00561  Glycerolipid metabolism
00620  Pyruvate metabolism
00625  Chloroalkane and chloroalkene degradation
00770  Pantothenate and CoA biosynthesis
00903  Limonene and pinene degradation
00981  Insect hormone biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS019024.29370-T1-C
LinkDB
Position
C909633:complement(2..340)
AA seq 113 aa
IFVQDTIYDKFVAELSALFDKVKVGLPWEESTQLGSLIYEAQVNKVLSYVDLAKEEGARI
VAGGVRVTDGELGKGCFVRPTLIVDATNDMRVAREEIFGPVAVVIKFHSEEEV

KEGG   T30397 (Metagenome): 21839
Entry
21839             CDS       T30397                                 

Definition
aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Best hit
ain:Acin_2364 (best score: 78.9517)
Pathway
00010  Glycolysis / Gluconeogenesis
00053  Ascorbate and aldarate metabolism
00071  Fatty acid degradation
00280  Valine, leucine and isoleucine degradation
00310  Lysine degradation
00330  Arginine and proline metabolism
00340  Histidine metabolism
00380  Tryptophan metabolism
00410  beta-Alanine metabolism
00561  Glycerolipid metabolism
00620  Pyruvate metabolism
00625  Chloroalkane and chloroalkene degradation
00770  Pantothenate and CoA biosynthesis
00903  Limonene and pinene degradation
00981  Insect hormone biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS019024.21839-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_25073:complement(2..160)
AA seq 53 aa
XIVWGKFLNAGQTCIAVDYVLVQRRVKDALVQALSAEIERRYPKAEQRESYPK

KEGG   T30397 (Metagenome): 21525
Entry
21525             CDS       T30397                                 

Definition
hypothetical protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Best hit
pdx:Psed_3755 (best score: 32.3426)
Pathway
00010  Glycolysis / Gluconeogenesis
00053  Ascorbate and aldarate metabolism
00071  Fatty acid degradation
00280  Valine, leucine and isoleucine degradation
00310  Lysine degradation
00330  Arginine and proline metabolism
00340  Histidine metabolism
00380  Tryptophan metabolism
00410  beta-Alanine metabolism
00561  Glycerolipid metabolism
00620  Pyruvate metabolism
00625  Chloroalkane and chloroalkene degradation
00770  Pantothenate and CoA biosynthesis
00903  Limonene and pinene degradation
00981  Insect hormone biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS019024.21525-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_24850:238..357
AA seq 40 aa
VWPAAEIVIADERRITDVPPGVVDVLTGPDAFAQLGDADI

KEGG   T30397 (Metagenome): 4411
Entry
4411              CDS       T30397                                 

Definition
aldehyde dehydrogenase B
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Best hit
fnu:FN0454 (best score: 62.7734)
Pathway
00010  Glycolysis / Gluconeogenesis
00053  Ascorbate and aldarate metabolism
00071  Fatty acid degradation
00280  Valine, leucine and isoleucine degradation
00310  Lysine degradation
00330  Arginine and proline metabolism
00340  Histidine metabolism
00380  Tryptophan metabolism
00410  beta-Alanine metabolism
00561  Glycerolipid metabolism
00620  Pyruvate metabolism
00625  Chloroalkane and chloroalkene degradation
00770  Pantothenate and CoA biosynthesis
00903  Limonene and pinene degradation
00981  Insect hormone biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS019024.4411-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_10802:complement(3..107)
AA seq 35 aa
XXXDIIDENKELLATVETMDNGKPIRETTLVDIPL

KEGG   T30397 (Metagenome): 31669
Entry
31669             CDS       T30397                                 

Definition
aldehyde dehydrogenase (NAD) family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Best hit
vpr:Vpar_1382 (best score: 332.028)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00010  Glycolysis / Gluconeogenesis
00053  Ascorbate and aldarate metabolism
00071  Fatty acid degradation
00280  Valine, leucine and isoleucine degradation
00310  Lysine degradation
00330  Arginine and proline metabolism
00340  Histidine metabolism
00380  Tryptophan metabolism
00410  beta-Alanine metabolism
00561  Glycerolipid metabolism
00620  Pyruvate metabolism
00625  Chloroalkane and chloroalkene degradation
00770  Pantothenate and CoA biosynthesis
00903  Limonene and pinene degradation
00981  Insect hormone biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS019024.31669-T1-C
LinkDB
Position
C917011:complement(3..497)
AA seq 165 aa
MSLNLKERYGLLINNEWVKASDGAEFNVYNPANGEQLAICAEATYGDVDKAVEAATEAFK
TWKNVSQVERADYLLKIADAIDAHKEHLAQVETYDNGKPIRETLNVDIPLGADHFRYFAG
VLRSEEGSAQVFDENTLSLIVREPIGVVGQVVPWNFPFLMAAWKL

KEGG   T30397 (Metagenome): 4576
Entry
4576              CDS       T30397                                 

Definition
aldehyde dehydrogenase B
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Best hit
fnc:HMPREF0946_00010 (best score: 80.4925)
Pathway
00010  Glycolysis / Gluconeogenesis
00053  Ascorbate and aldarate metabolism
00071  Fatty acid degradation
00280  Valine, leucine and isoleucine degradation
00310  Lysine degradation
00330  Arginine and proline metabolism
00340  Histidine metabolism
00380  Tryptophan metabolism
00410  beta-Alanine metabolism
00561  Glycerolipid metabolism
00620  Pyruvate metabolism
00625  Chloroalkane and chloroalkene degradation
00770  Pantothenate and CoA biosynthesis
00903  Limonene and pinene degradation
00981  Insect hormone biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS019024.4576-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_11106:complement(193..336)
AA seq 48 aa
SEYGLGGAVFTKNINRAFRIAREIQTGRVWINTYNQIPEHXXXXXXXX

KEGG   T30397 (Metagenome): 29035
Entry
29035             CDS       T30397                                 

Definition
aldehyde dehydrogenase (NAD) family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Best hit
vpr:Vpar_1382 (best score: 203.756)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00010  Glycolysis / Gluconeogenesis
00053  Ascorbate and aldarate metabolism
00071  Fatty acid degradation
00280  Valine, leucine and isoleucine degradation
00310  Lysine degradation
00330  Arginine and proline metabolism
00340  Histidine metabolism
00380  Tryptophan metabolism
00410  beta-Alanine metabolism
00561  Glycerolipid metabolism
00620  Pyruvate metabolism
00625  Chloroalkane and chloroalkene degradation
00770  Pantothenate and CoA biosynthesis
00903  Limonene and pinene degradation
00981  Insect hormone biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS019024.29035-T1-C
LinkDB
Position
C908574:1..297
AA seq 98 aa
KFHSEEEVIEQANDSLYGLGGGVFTQNINRAIRVARGIETGRMWVNTYNSIPAGAPFGGY
KQSGIGRETHKVILEHYTQMKNIIVNLSDKPSGFYDLD

DBGET integrated database retrieval system