KEGG   T30397 (Metagenome): 29530
Entry
29530             CDS       T30397                                 

Gene name
serA
Definition
phosphoglycerate dehydrogenase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Best hit
hin:HI0465 (best score: 129.028)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00260  Glycine, serine and threonine metabolism
00270  Cysteine and methionine metabolism
00680  Methane metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.29530-T1-C
LinkDB
Position
C910217:complement(142..348)
AA seq 68 aa
LHIHENRPGVLNKLNQIFVEANLNIAAQYLQTDPKIGYVVVDVETDDASPLLAKLREIEG
TIKARVLY

KEGG   T30397 (Metagenome): 10812
Entry
10812             CDS       T30397                                 

Gene name
pdxB
Definition
phosphoglycerate dehydrogenase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Best hit
aap:NT05HA_2355 (best score: 71.6329)
Pathway
00260  Glycine, serine and threonine metabolism
00270  Cysteine and methionine metabolism
00680  Methane metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.10812-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_16999:3..131
AA seq 43 aa
LEELLGSCDVISLHVPDLPSTRNLMSAERIAQLKQDSXXXXXX

KEGG   T30397 (Metagenome): 20631
Entry
20631             CDS       T30397                                 

Gene name
acuB
Definition
acetoin utilization protein acuB
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Best hit
pfac:PFJ30894_00986 (best score: 36.5798)
Pathway
00260  Glycine, serine and threonine metabolism
00270  Cysteine and methionine metabolism
00680  Methane metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.20631-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_24226:3..170
AA seq 56 aa
IEISGYNTPGSRLFIEINEDKPGPLEEISDVLRENNVNVSTISVYHRDGXXXXXXX

KEGG   T30397 (Metagenome): 17720
Entry
17720             CDS       T30397                                 

Gene name
serA
Definition
phosphoglycerate dehydrogenase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Best hit
apag:EIA51_09505 (best score: 88.1965)
Pathway
00260  Glycine, serine and threonine metabolism
00270  Cysteine and methionine metabolism
00680  Methane metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.17720-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_22115:complement(1..144)
AA seq 48 aa
XXXNQVDLDAAKMRGIPVFNAPFSNTRSVAELVLGEILLLMRNIPQAN

KEGG   T30397 (Metagenome): 10813
Entry
10813             CDS       T30397                                 

Gene name
serA
Definition
phosphoglycerate dehydrogenase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Best hit
hin:HI0465 rpne:NCTC8284_03974 (best score: 64.3142)
Pathway
00260  Glycine, serine and threonine metabolism
00270  Cysteine and methionine metabolism
00680  Methane metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.10813-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_16999:225..323
AA seq 33 aa
XXXHIGGSTAEAQENIGFEVAGKFVKYSDNGST

KEGG   T30397 (Metagenome): 8241
Entry
8241              CDS       T30397                                 

Gene name
pdxB
Definition
phosphoglycerate dehydrogenase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Best hit
fnu:FN0965 (best score: 69.707)
Pathway
00260  Glycine, serine and threonine metabolism
00270  Cysteine and methionine metabolism
00680  Methane metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.8241-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_15024:2..124
AA seq 41 aa
NIIASAATDVMTTEPPKNDCKLLELDNFTVTPHLAXXXXXX

DBGET integrated database retrieval system