KEGG   T30397 (Metagenome): 30020
Entry
30020             CDS       T30397                                 

Gene name
crr
Definition
glucose-specific phosphotransferase enzyme IIA component
  KO
K02777  sugar PTS system EIIA component [EC:2.7.1.-]
Best hit
hin:HI1711 (best score: 115.931)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00010  Glycolysis / Gluconeogenesis
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
02026  Biofilm formation - Escherichia coli
02060  Phosphotransferase system (PTS)
05111  Biofilm formation - Vibrio cholerae
Other DBs
HMP: SRS019024.30020-T1-C
LinkDB
Position
C911851:3..209
AA seq 68 aa
EGFTRIAQEGQNVKRGDTVIEFDLATLESKAKSVLTPVVISNMDEISSIEKKSGEVIAGE
SVVLSLTK

KEGG   T30397 (Metagenome): 9791
Entry
9791              CDS       T30397                                 

Gene name
ptbA
Definition
PTS system, glucose subfamily, IIA component
  KO
K02777  sugar PTS system EIIA component [EC:2.7.1.-]
Best hit
rmu:RMDY18_00840 (best score: 299.286)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00010  Glycolysis / Gluconeogenesis
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
02026  Biofilm formation - Escherichia coli
02060  Phosphotransferase system (PTS)
05111  Biofilm formation - Vibrio cholerae
Other DBs
HMP: SRS019024.9791-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_16218:542..1054
AA seq 170 aa
MFGFGKKKKEAAAQEAASADVYVAPVTGEYLPLSEVSDPVFSQGVMGDGYAVNPTAGTIV
APVAGTIALIQDTLHAFMLRTDNGGEVLVHIGIDTVELGGEGFTKIANVGDKVEAGAPII
EVDWAAIEGRIPSKETMVMITNTAKFNISKDSEARRPVNAGDRVAQATKK

DBGET integrated database retrieval system