KEGG   T30397 (Metagenome): 30462
Entry
30462             CDS       T30397                                 

Definition
succinate coA transferase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Best hit
vpr:Vpar_1249 (best score: 273.092)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00650  Butanoate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.30462-T1-C
LinkDB
Position
C913225:complement(1..402)
AA seq 134 aa
PFKIDLWTGASVGDEADGALTRANGINRRFPYQTNKDMRKALNSGDVKYIDMHLSTMAQN
IRYGFFGDLDVAIIEVCQINEDGSLVPTTSVGNSPTFVSQAKKVIVEVNVSQPLSLVGMH
DIYEPLDPPHRKPI

KEGG   T30397 (Metagenome): 30840
Entry
30840             CDS       T30397                                 

Definition
hypothetical protein
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Best hit
vpr:Vpar_1249 (best score: 281.182)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00650  Butanoate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.30840-T1-C
LinkDB
Position
C914477:1..432
AA seq 144 aa
HLSTMAQNVRYGFFGDLDVAIVEVCQINEDGSLVPTTSVGNSPTFVSQAKKVIVEVNVSQ
PLSLVGMHDIYEPLDPPHRKPIPLETPGDRIGTEAIPCDPSKIVAVVPCDVPDTTRPLAP
IDDDAKAMSQHLIKFFEQEIAEGR

KEGG   T30397 (Metagenome): 32034
Entry
32034             CDS       T30397                                 

Definition
succinate coA transferase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Best hit
vpr:Vpar_1249 (best score: 414.461)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00650  Butanoate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.32034-T1-C
LinkDB
Position
C917965:2..616
AA seq 205 aa
GRLPKNLLPLQSGVGSVANAVISGLAQGPFTDLSIYTEVIQDGMFDLIDAGKVTVCSGTA
LSPSPDGLKRFYANIDEYRKKIILRPQEISNNPGIARRIGVIAMNTAIEFDIFGNVNSTH
IMGSKMMNGVGGSGDFARSAYLTIFCTNSVAKNGDISSIVPYVSHVDHPEHDTMIFCTEQ
GVADCRGLSPVERARLIIEKCAHPD

KEGG   T30397 (Metagenome): 10460
Entry
10460             CDS       T30397                                 

Definition
succinate coA transferase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Best hit
cgl:NCgl2480 (best score: 67.0106)
Pathway
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00650  Butanoate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.10460-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_16737:complement(2..121)
AA seq 40 aa
XXXEYAERMNNEASRYSKQIILRPQQISNHPEVIRRLGLI

DBGET integrated database retrieval system