KEGG   T30397 (Metagenome): 31699
Entry
31699             CDS       T30397                                 

Gene name
ppsA
Definition
pyruvate, water dikinase
  KO
K01007  pyruvate, water dikinase [EC:2.7.9.2]
Best hit
vpr:Vpar_1061 (best score: 189.504)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00010  Glycolysis / Gluconeogenesis
00620  Pyruvate metabolism
00680  Methane metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.31699-T1-C
LinkDB
Position
C917093:complement(260..550)
AA seq 96 aa
ETVQHIYDERNLAVRRAIRHLIEVAHKDGKTVSICGQAPSVYPELCEFLVKSGIDSISVN
PDAVVNTKKMVAQIEQRIMLDAMTGRGRQESDELIW

KEGG   T30397 (Metagenome): 30516
Entry
30516             CDS       T30397                                 

Gene name
ppsA
Definition
pyruvate, water dikinase
  KO
K01007  pyruvate, water dikinase [EC:2.7.9.2]
Best hit
vpr:Vpar_1061 (best score: 275.018)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00010  Glycolysis / Gluconeogenesis
00620  Pyruvate metabolism
00680  Methane metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.30516-T1-C
LinkDB
Position
C913437:1..405
AA seq 135 aa
PRQVVVRLSDFKSSEYRDLKGGDKYEPHESSALLGWRGASRYYDPKYTPAFKLELEAIKK
VRNEFGFKNLQVMIPFCRTVEEAELVTNLMAQEGLARSKDFKVWLMAEIPSNIILADQFN
KYVDGYSIGSNDLTM

KEGG   T30397 (Metagenome): 31834
Entry
31834             CDS       T30397                                 

Gene name
ppsA
Definition
pyruvate, water dikinase
  KO
K01007  pyruvate, water dikinase [EC:2.7.9.2]
Best hit
vpr:Vpar_1061 (best score: 385.956)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00010  Glycolysis / Gluconeogenesis
00620  Pyruvate metabolism
00680  Methane metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.31834-T1-C
LinkDB
Position
C917439:2..574
AA seq 191 aa
GVMFTVDLVTGNDNNILIEGSWGLGEYVVQGTVTPDNFRVDKEKMEITDRMINDKHVRLV
RKADGDCVEEVVPADEAKQQVITDAQVLELAEYAKAIEKHYGCYMDMEWGVDERNDKIWI
LQARPETVWSRKEKSETSEKASTLDAGNRDIIVKGLPASPGNAAGKAHVIINPEDIDEFK
EGEILVTAMTA

KEGG   T30397 (Metagenome): 6389
Entry
6389              CDS       T30397                                 

Gene name
ppsA
Definition
pyruvate, water dikinase
  KO
K01007  pyruvate, water dikinase [EC:2.7.9.2]
Best hit
vpr:Vpar_1061 (best score: 140.584)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00010  Glycolysis / Gluconeogenesis
00620  Pyruvate metabolism
00680  Methane metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.6389-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_13447:complement(180..401)
AA seq 74 aa
LSDFKSSEYRDLNGGDKYEPHESSALLGWRGAARYYDPKYTPAFKLELEAIKKVRNEFGF
KNLQVMIPXXXXXX

KEGG   T30397 (Metagenome): 27045
Entry
27045             CDS       T30397                                 

Definition
hypothetical protein
  KO
K01007  pyruvate, water dikinase [EC:2.7.9.2]
Best hit
vpr:Vpar_1061 (best score: 203.371)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00010  Glycolysis / Gluconeogenesis
00620  Pyruvate metabolism
00680  Methane metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.27045-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_28651:3..320
AA seq 106 aa
YDGVLEDIVKKPEAQATASVATEYVPVTGTKIYMNLGNPDLAEKHGVLPCDGIGLMREEF
IWTTFIHEHPLHLIETGRSDFAVNTLAEGMRKVCQALAPRQVVVRL

KEGG   T30397 (Metagenome): 6388
Entry
6388              CDS       T30397                                 

Definition
hypothetical protein
  KO
K01007  pyruvate, water dikinase [EC:2.7.9.2]
Best hit
vpr:Vpar_1061 (best score: 67.781)
Pathway
00010  Glycolysis / Gluconeogenesis
00620  Pyruvate metabolism
00680  Methane metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.6388-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_13447:complement(1..114)
AA seq 38 aa
XXXXCRTVEEAELVTNLMAQEGLVRGKDFKIWLMAEIP

DBGET integrated database retrieval system