KEGG   T30397 (Metagenome): 32174
Entry
32174             CDS       T30397                                 

Definition
cysteine synthase
  KO
K01738  cysteine synthase [EC:2.5.1.47]
Best hit
vpr:Vpar_1580 (best score: 338.961)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00270  Cysteine and methionine metabolism
00920  Sulfur metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.32174-T1-C
LinkDB
Position
C918329:1..519
AA seq 172 aa
AGAIEAGQFVNQANPAIHYRTTGPEIWQDTDGTVDIYVSGVGTGGTLTGAGRYLKEQNPD
VHVVAVEPADSPVLSNGKPGPHKIQGLGAGFIPDTLDTNIYDEVIQVSNEDAFATSQAFG
HTEGVLVGISSGAALWAAQELAKRPENKGKNIVVILPDTGERYLSTALFPEV

KEGG   T30397 (Metagenome): 16426
Entry
16426             CDS       T30397                                 

Gene name
cysK
Definition
cysteine synthase
  KO
K01738  cysteine synthase [EC:2.5.1.47]
Best hit
mmt:Metme_2788 (best score: 67.3958)
Pathway
00270  Cysteine and methionine metabolism
00920  Sulfur metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.16426-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_21172:231..362
AA seq 44 aa
XXXXVLTPGSEGMKGAIAKAQEIAAERDGFLPLQFNNPANPEVH

KEGG   T30397 (Metagenome): 11666
Entry
11666             CDS       T30397                                 

Definition
hypothetical protein
  KO
K01738  cysteine synthase [EC:2.5.1.47]
Best hit
rmu:RMDY18_07950 (best score: 40.4318)
Pathway
00270  Cysteine and methionine metabolism
00920  Sulfur metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.11666-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_17658:243..308
AA seq 22 aa
XXXRRVLLRAYGAQIVLTPGTE

KEGG   T30397 (Metagenome): 28601
Entry
28601             CDS       T30397                                 

Definition
cysteine synthase
  KO
K01738  cysteine synthase [EC:2.5.1.47]
Best hit
pru:PRU_2792 (best score: 162.155)
Taxonomy
Bacteroidetes [GN:pru]
Pathway
00270  Cysteine and methionine metabolism
00920  Sulfur metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.28601-T1-C
LinkDB
Position
C907042:complement(12..314)
AA seq 100 aa
GESGPHKIQGIGAGFVPNTYNNKYVDEIFQVENDQAILAGRQLAQQEGLLVGISSGAAAF
AATEIAKRPENAGKTIVTLLPDTGERYLSTVLYAFDEYPL

KEGG   T30397 (Metagenome): 22347
Entry
22347             CDS       T30397                                 

Gene name
cysK
Definition
cysteine synthase
  KO
K01738  cysteine synthase [EC:2.5.1.47]
Best hit
lla:L0088 (best score: 150.599)
Taxonomy
Firmicutes - Bacilli [GN:lla]
Pathway
00270  Cysteine and methionine metabolism
00920  Sulfur metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.22347-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_25443:1..327
AA seq 109 aa
YGAELVLTPGSDGMKGAIAKAQEIATERDGFLPLQFNNPANPEVHERTTGAEILAAFGSN
GLDAFVGGVGTGGTISGVSHALKAANSNIQVFAVEADESAILSGEKPGP

KEGG   T30397 (Metagenome): 30127
Entry
30127             CDS       T30397                                 

Definition
putative cysteine synthase A
  KO
K01738  cysteine synthase [EC:2.5.1.47]
Best hit
vpr:Vpar_0141 (best score: 101.293)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00270  Cysteine and methionine metabolism
00920  Sulfur metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.30127-T1-C
LinkDB
Position
C912175:complement(216..380)
AA seq 54 aa
RESGISIGLSAGAAIVAAKRMARELPKANIVVIAPDGVEKYLSLLDFGNNEYVK

KEGG   T30397 (Metagenome): 31074
Entry
31074             CDS       T30397                                 

Definition
cysteine synthase
  KO
K01738  cysteine synthase [EC:2.5.1.47]
Best hit
rmu:RMDY18_07950 (best score: 268.855)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00270  Cysteine and methionine metabolism
00920  Sulfur metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.31074-T1-C
LinkDB
Position
C915245:complement(26..457)
AA seq 143 aa
GKVDIFVAGIGTGGTISGSGKYLKEQNPNIKVVAVEPKDSPLLSEGRVGPHKIQGLGANF
VPETLDRGIYDSVTAVSAEDAMRTSRLLATQEGILGGISSGAAVWAALEEAKKSENKDKL
IVAIVPDFGERYISTALYEDIRG

KEGG   T30397 (Metagenome): 11665
Entry
11665             CDS       T30397                                 

Definition
cysteine synthase
  KO
K01738  cysteine synthase [EC:2.5.1.47]
Best hit
rmu:RMDY18_07950 (best score: 74.3294)
Pathway
00270  Cysteine and methionine metabolism
00920  Sulfur metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.11665-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_17658:2..133
AA seq 44 aa
EGLPGNVAVKLEFYNPAGSVKDRIGRAIIDAAEESGALXXXXXX

KEGG   T30397 (Metagenome): 32262
Entry
32262             CDS       T30397                                 

Definition
putative cysteine synthase A
  KO
K01738  cysteine synthase [EC:2.5.1.47]
Best hit
vpr:Vpar_0141 (best score: 433.335)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00270  Cysteine and methionine metabolism
00920  Sulfur metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.32262-T1-C
LinkDB
Position
C918561:complement(1..696)
AA seq 232 aa
YVKLEKYNVGGSVKDRAVLGMLQAAREQGRIHEDSIIVEATSGNTGIALAMVGAILHIKT
VIIMPESMSKERRELIKAYGAQLILTPKETGMKGALERANEILEKYPNAFTLGQFVNPAN
PDMHYRTTGTEIVEQVPNVDVFVAGIGTGGTFTGVTRRLKEHNPNLKAIAVEPTGSPAIT
EGKGGPHKIQGIGAGFIPENFDQTLMDGVQTVSDEEAFSEVQTFMRESGISI

DBGET integrated database retrieval system