KEGG   T30397 (Metagenome): 32645
Entry
32645             CDS       T30397                                 

Definition
pyruvate dehydrogenase E1 component
  KO
K00163  pyruvate dehydrogenase E1 component [EC:1.2.4.1]
Best hit
rmu:RMDY18_07900 (best score: 313.923)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.32645-T1-C
LinkDB
Position
C919358:402..863
AA seq 154 aa
LANVPNEHSLSTLLDGLKDIDVEETQEWAESLEDLIKTHGTERAEYILRALLKEAGEKGV
KVPTLVKTDYINTIPVDQQPEYPGDEELERQYRAWIRWNAAIMVQRAQKKGIGVGGHIST
FAGVADLYEMGQNHFFRGRNHPGGGDQVFFQGHS

KEGG   T30397 (Metagenome): 18207
Entry
18207             CDS       T30397                                 

Definition
pyruvate dehydrogenase E1 component
  KO
K00163  pyruvate dehydrogenase E1 component [EC:1.2.4.1]
Best hit
rmu:RMDY18_07900 (best score: 94.7449)
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.18207-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_22467:2..163
AA seq 54 aa
TDYTSDVPDQIRQFVPNDFATLGADGFGFADTRPGARRFFHIDAESXXXXXXXX

KEGG   T30397 (Metagenome): 27559
Entry
27559             CDS       T30397                                 

Definition
pyruvate dehydrogenase E1 component
  KO
K00163  pyruvate dehydrogenase E1 component [EC:1.2.4.1]
Best hit
rmu:RMDY18_07900 (best score: 654.055)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.27559-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_28983:2..946
AA seq 315 aa
QGHSSPGVYSRAFVEGVLTEEQMDGFRQEKTKGANGIPSYPHPRCMPEFWQFPTVSMGLG
PLNAIHQASFNKYLHNHKIKDTSEQHVWAFLGDGEMDEPESRGALQLAANEHLDNLTFVI
NCNLQRLDGPVRGNGKIVQELEAFFRGAGWHVIKVLWGSDYDELLKKDKSGKLIQLMNET
LDGDYQTFRGEDGGYIREHFFGKYPETKELVADLTDEQIFNLRLGGHDDKKLYAAYKEAM
ETKGKPTVILAQSIKGAELGPYFEARNSTHQIKKFTMEALKGFRDHLNIPISDEELEKDL
YNPPYYLPEANHPAL

KEGG   T30397 (Metagenome): 22049
Entry
22049             CDS       T30397                                 

Definition
hypothetical protein
  KO
K00163  pyruvate dehydrogenase E1 component [EC:1.2.4.1]
Best hit
frp:AX769_13720 ars:ADJ73_14090 ane:AN27039_2453 (best score:
36.965)
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.22049-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_25223:complement(227..310)
AA seq 28 aa
DYYTLGADGFGFSDTRAAARRXXXXXXX

KEGG   T30397 (Metagenome): 24900
Entry
24900             CDS       T30397                                 

Gene name
aceE
Definition
pyruvate dehydrogenase E1 component
  KO
K00163  pyruvate dehydrogenase E1 component [EC:1.2.4.1]
Best hit
rmu:RMDY18_07900 (best score: 335.495)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.24900-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_27212:2..490
AA seq 163 aa
FWAAADQMCRGFVIGATAGRTTLSGEGLQHNDGHSPILASTNPAFKIYDPAYGYEIAHIV
ERGIEQMYGTKDEDHNVMYYLTVYNEPIHQPAEPANVDVEGIIKGIHKISESPLTSGPKA
QLLASGVAVPWAEKAQKLLAEDWGVSADLWSVTSWTELRRDGV

KEGG   T30397 (Metagenome): 594
Entry
594               CDS       T30397                                 

Definition
pyruvate dehydrogenase, decarboxylase component E1, thiamin-binding
  KO
K00163  pyruvate dehydrogenase E1 component [EC:1.2.4.1]
Best hit
aap:NT05HA_0656 (best score: 109.768)
Taxonomy
Gammaproteobacteria - Others [GN:aap]
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.594-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_1709:complement(3..167)
AA seq 55 aa
XHEDGHSHIQSLVIPNCVSYDPAYVYEVAVILQDGINRMYGEKQEDVFYYITTLN

KEGG   T30397 (Metagenome): 18208
Entry
18208             CDS       T30397                                 

Gene name
aceE
Definition
pyruvate dehydrogenase E1 component
  KO
K00163  pyruvate dehydrogenase E1 component [EC:1.2.4.1]
Best hit
rmu:RMDY18_07900 (best score: 67.781)
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.18208-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_22467:223..327
AA seq 34 aa
XLAKRGEVAADVPAKAFAKYDLLNVNANSELEQH

KEGG   T30397 (Metagenome): 5430
Entry
5430              CDS       T30397                                 

Gene name
aceE
Definition
pyruvate dehydrogenase E1 component
  KO
K00163  pyruvate dehydrogenase E1 component [EC:1.2.4.1]
Best hit
rmu:RMDY18_07900 (best score: 68.5514)
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.5430-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_12521:complement(3..107)
AA seq 35 aa
XXXFKDIDVEETQEWAESLEDLIKTHGTERAEYIL

KEGG   T30397 (Metagenome): 595
Entry
595               CDS       T30397                                 

Definition
pyruvate dehydrogenase, decarboxylase component E1, thiamin-binding
  KO
K00163  pyruvate dehydrogenase E1 component [EC:1.2.4.1]
Best hit
ppr:PBPRA3196 (best score: 65.0846)
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.595-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_1709:complement(424..582)
AA seq 53 aa
NYLHGKRKALNGYLPKRLPKFTTEFKVPALEEFAPLLEEQARPISXXXXXXXX

KEGG   T30397 (Metagenome): 10051
Entry
10051             CDS       T30397                                 

Definition
hypothetical protein
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Best hit
crn:CAR_c09180 (best score: 46.595)
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
04066  HIF-1 signaling pathway
04922  Glucagon signaling pathway
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS019024.10051-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_16424:complement(1..69)
AA seq 23 aa
MDPLAVYAVTKKAREYAVAGNGP

KEGG   T30397 (Metagenome): 23903
Entry
23903             CDS       T30397                                 

Definition
pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1)
component, eukaryotic type, alpha subunit
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Best hit
rmu:RMDY18_02170 (best score: 144.436)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
04066  HIF-1 signaling pathway
04922  Glucagon signaling pathway
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS019024.23903-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_26521:complement(364..603)
AA seq 79 aa
DPMIRLEKYLREQGYADDAFFEEVAESAQKVASGVRDAVLSAEVADFEHFFDRVYAQEHQ
QVEDDREFYRTYNAGFEEE

KEGG   T30397 (Metagenome): 10052
Entry
10052             CDS       T30397                                 

Gene name
pdhA
Definition
pyruvate dehydrogenase complex E1 component, alpha subunit
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Best hit
jep:BW721_04530 (best score: 195.282)
Taxonomy
Firmicutes - Bacilli [GN:jep]
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
04066  HIF-1 signaling pathway
04922  Glucagon signaling pathway
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS019024.10052-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_16424:complement(75..482)
AA seq 135 aa
IKAIEKDDVLLPGYRDVPQLVKHGLPLSQAFLWSRGHVAGNMYPESLKALPPQIIIGAQY
VQAAGVALGLKKRGKKNVAVTYTGDGGSSQGDFYEGINYAGAYKSPAXXXXXXXXXXXXX
XXXKKQLLLVFLVSK

KEGG   T30397 (Metagenome): 3168
Entry
3168              CDS       T30397                                 

Definition
hypothetical protein
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Best hit
kpul:GXN76_11750 (best score: 30.4166)
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
04066  HIF-1 signaling pathway
04922  Glucagon signaling pathway
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS019024.3168-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_8321:complement(416..508)
AA seq 31 aa
IEGLGFRRIDAIAQQLEIAADSLYXXXXXXX

KEGG   T30397 (Metagenome): 5937
Entry
5937              CDS       T30397                                 

Definition
pyruvate dehydrogenase E1 component subunit beta
  KO
K00162  pyruvate dehydrogenase E1 component beta subunit [EC:1.2.4.1]
Best hit
rmu:RMDY18_02180 (best score: 152.91)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
04066  HIF-1 signaling pathway
04922  Glucagon signaling pathway
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS019024.5937-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_13047:complement(466..693)
AA seq 75 aa
VAKTGRLIIAHEAPTFGGMGGELASAITERCFYSLQAPVIRVGGYYMPYPVSRVEEEYVP
DIDRILEAVDRAFDY

KEGG   T30397 (Metagenome): 23901
Entry
23901             CDS       T30397                                 

Definition
pyruvate dehydrogenase E1 component subunit beta
  KO
K00162  pyruvate dehydrogenase E1 component beta subunit [EC:1.2.4.1]
Best hit
rmu:RMDY18_02180 (best score: 115.931)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
04066  HIF-1 signaling pathway
04922  Glucagon signaling pathway
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS019024.23901-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_26521:complement(1..180)
AA seq 60 aa
XXXALRGYRPVPEIQFDGFVFPAFNQITSQLAKIHNRTDKQYIVPVTIRIPYGGVIGSVE

DBGET integrated database retrieval system