KEGG   T30397 (Metagenome): 32932
Entry
32932             CDS       T30397                                 

Gene name
lpxA
Definition
acyl-[acyl-carrier-protein]-UDP-N-acetylglucosamine
O-acyltransferase
  KO
K00677  UDP-N-acetylglucosamine acyltransferase [EC:2.3.1.129]
Best hit
vpr:Vpar_0535 (best score: 527.324)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00540  Lipopolysaccharide biosynthesis
01100  Metabolic pathways
01503  Cationic antimicrobial peptide (CAMP) resistance
Other DBs
HMP: SRS019024.32932-T1-C
LinkDB
Position
C919894:complement(18..815)
AA seq 265 aa
MENAKSNIHSTAIVHPNAKLGKDVIVGPGAVIGEHVEIGDGTQIGAHVVIGGWTTIGKRC
EIYPNASIGLEPQDLKFKGEKSYCNIGDETVIREFVTISRATGEGEETRVGNNCLLQACT
HVAHNCIVGNNVIMSNCAGLAGHAIVEDRVVIGGLAGIHQFVKIGRNAMVGGMAKVVQDI
PPYVIADGQPARVIGLNSVGLSRAGISEDVRRDLKQAFRIIYRSGFSLSKAIEEMELQLD
SSVEIENLLRFLRNADRGIMRTRRD

KEGG   T30397 (Metagenome): 5345
Entry
5345              CDS       T30397                                 

Definition
hypothetical protein
  KO
K00677  UDP-N-acetylglucosamine acyltransferase [EC:2.3.1.129]
Best hit
mmob:F6R98_16220 (best score: 47.7506)
Pathway
00540  Lipopolysaccharide biosynthesis
01100  Metabolic pathways
01503  Cationic antimicrobial peptide (CAMP) resistance
Other DBs
HMP: SRS019024.5345-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_12372:complement(2..103)
AA seq 34 aa
XEAKLGEGVIVHPFAVIEENTEIGEGCIIESHAV

DBGET integrated database retrieval system