KEGG   T30397 (Metagenome): 3482
Entry
3482              CDS       T30397                                 

Gene name
lpxH
Definition
UDP-2,3-diacylglucosamine hydrolase
  KO
K03269  UDP-2,3-diacylglucosamine hydrolase [EC:3.6.1.54]
Best hit
paet:NCTC13378_01404 (best score: 58.5362)
Pathway
00540  Lipopolysaccharide biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS019024.3482-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_8905:complement(2..103)
AA seq 34 aa
XMQNKAQEAQAVYILGDLFDFWIGDDETSPLISQ

KEGG   T30397 (Metagenome): 448
Entry
448               CDS       T30397                                 

Definition
ser/thr phosphatase family protein
  KO
K03269  UDP-2,3-diacylglucosamine hydrolase [EC:3.6.1.54]
Best hit
bth:BT_3697 (best score: 48.1358)
Pathway
00540  Lipopolysaccharide biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS019024.448-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_1254:222..302
AA seq 27 aa
MLILGDWIWQFTYAVFDGEHMFLEEYV

DBGET integrated database retrieval system