KEGG   T30397 (Metagenome): 3880
Entry
3880              CDS       T30397                                 

Definition
aconitase A
  KO
K01681  aconitate hydratase [EC:4.2.1.3]
Best hit
hor:Hore_21050 (best score: 102.064)
Taxonomy
Firmicutes - Clostridia [GN:hor]
Pathway
00020  Citrate cycle (TCA cycle)
00630  Glyoxylate and dicarboxylate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.3880-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_9722:169..333
AA seq 55 aa
XXXAVIHQYMRETMAGCGKMILGSDSHTRYGALGTMAIGEGGPELVKQLLGRTYD

KEGG   T30397 (Metagenome): 12818
Entry
12818             CDS       T30397                                 

Definition
aconitate hydratase domain protein
  KO
K01681  aconitate hydratase [EC:4.2.1.3]
Best hit
ebm:SG0102_04030 (best score: 72.4034)
Pathway
00020  Citrate cycle (TCA cycle)
00630  Glyoxylate and dicarboxylate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.12818-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_18540:204..320
AA seq 39 aa
XAVIHTYMRENFAAPGKMILGSDSHTRYGAIGTMAIGEG

KEGG   T30397 (Metagenome): 26685
Entry
26685             CDS       T30397                                 

Definition
aconitase A
  KO
K01681  aconitate hydratase [EC:4.2.1.3]
Best hit
afn:Acfer_0096 (best score: 111.694)
Taxonomy
Firmicutes - Others [GN:afn]
Pathway
00020  Citrate cycle (TCA cycle)
00630  Glyoxylate and dicarboxylate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.26685-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_28420:3..254
AA seq 84 aa
EKSRQEGESAADLVTAYEEVKQALGLTESVEDMAKSTAVSSMVYANRPGDGSAREQAASC
QRVLGGGANIAIEYATKXXXXXXX

KEGG   T30397 (Metagenome): 26686
Entry
26686             CDS       T30397                                 

Definition
aconitase A
  KO
K01681  aconitate hydratase [EC:4.2.1.3]
Best hit
afn:Acfer_0096 (best score: 56.9954)
Pathway
00020  Citrate cycle (TCA cycle)
00630  Glyoxylate and dicarboxylate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.26686-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_28420:282..428
AA seq 48 aa
XXXDYKAYVISGGVKKAEITLHLGHLSDEEKDIIAAGCLINYYANSKA

KEGG   T30397 (Metagenome): 17952
Entry
17952             CDS       T30397                                 

Definition
hypothetical protein
  KO
K01682  aconitate hydratase 2 / 2-methylisocitrate dehydratase [EC:4.2.1.3 4.2.1.99]
Best hit
lcq:111677011 (best score: 25.409)
Pathway
00020  Citrate cycle (TCA cycle)
00630  Glyoxylate and dicarboxylate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.17952-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_22280:3..89
AA seq 28 aa
EEILFVQAFCHTSGMNNIVKLMSRELFF

DBGET integrated database retrieval system