KEGG   T30397 (Metagenome): 5436
Entry
5436              CDS       T30397                                 

Definition
dihydrolipoamide acetyltransferase component of pyruvate
dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Best hit
aap:NT05HA_0657 (best score: 63.1586)
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.5436-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_12530:2..124
AA seq 41 aa
FRKEQNALAEKQKLGVKITPVVFIMKAVAKALEXXXXXXXX

KEGG   T30397 (Metagenome): 19034
Entry
19034             CDS       T30397                                 

Gene name
aceF
Definition
pyruvate dehydrogenase complex E2 component, dihydrolipoamide
acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Best hit
lpl:lp_2152 (best score: 60.077)
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.19034-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_23050:complement(3..146)
AA seq 48 aa
XAPAAAPAAPAAPTGVPAASNPGKLVLAMPSVRQYAREKGVDITAVVP

KEGG   T30397 (Metagenome): 19035
Entry
19035             CDS       T30397                                 

Gene name
aceF
Definition
pyruvate dehydrogenase complex E2 component, dihydrolipoamide
acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Best hit
vte:BHY08_08225 (best score: 46.2098)
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.19035-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_23050:complement(214..393)
AA seq 60 aa
XXXXAPAAAPAPAAPAASSTFQFKLPDIGEGIAEGEIVKIDIKVGDKIAEDDXXXXXXXX

KEGG   T30397 (Metagenome): 23139
Entry
23139             CDS       T30397                                 

Gene name
acoC
Definition
TPP-dependent acetoin dehydrogenase complex, E2 component,
dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Best hit
got:AXE85_07640 (best score: 70.4774)
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.23139-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_25986:3..182
AA seq 60 aa
AAAPVEEAVVEAKVEATPAQEVEVFDNSGLRATPAARAYARENGIDLSQVKGTGXXXXXX

KEGG   T30397 (Metagenome): 5936
Entry
5936              CDS       T30397                                 

Gene name
pdhC
Definition
dihydrolipoyllysine-residue acetyltransferase component of pyruvate
dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Best hit
rmu:RMDY18_02190 (best score: 83.1889)
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.5936-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_13047:complement(193..354)
AA seq 54 aa
MSQIFSLPDVGEGLTEAEILSWKVATGTEVAINDVLVEIETAKSVVXXXXXXXX

KEGG   T30397 (Metagenome): 23140
Entry
23140             CDS       T30397                                 

Gene name
acoC
Definition
TPP-dependent acetoin dehydrogenase complex, E2 component,
dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Best hit
got:AXE85_07640 (best score: 65.855)
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.23140-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_25986:231..371
AA seq 47 aa
MSPLAARIAEVEGINTDGIVGTGPKGKIMKADVLSVLNGSASEAAAS

KEGG   T30397 (Metagenome): 5437
Entry
5437              CDS       T30397                                 

Definition
dihydrolipoyllysine-residue acetyltransferase E2 component of
pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Best hit
aap:NT05HA_0657 (best score: 82.4185)
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.5437-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_12530:175..309
AA seq 45 aa
XXXINIGVAVDTPNGLVVPVFKDVNKKGIIELSRELAEVSKKARD

KEGG   T30397 (Metagenome): 29487
Entry
29487             CDS       T30397                                 

Definition
macA
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Best hit
tmz:Tmz1t_3196 (best score: 47.3654)
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.29487-T1-C
LinkDB
Position
C910051:3..347
AA seq 115 aa
SKGDLDEILVSVGDKVSEGQALVKYSSSEAQAAYDSASRAVAKADRHINELNQARNEAAS
APAPQLPTPAGVEGAAAQTPAPVAGNSVSSIDAQLGDARDARADAEAQLSKAQSQ

KEGG   T30397 (Metagenome): 9779
Entry
9779              CDS       T30397                                 

Definition
pyruvate dehydrogenase complex, dihydrolipoyllysine-residue
acetyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Best hit
rmu:RMDY18_02190 (best score: 73.9442)
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.9779-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_16208:1..132
AA seq 44 aa
RGLMVPNIKDAQELSLRELAVALNNLTTRAREGKTQPXXXXXXX

KEGG   T30397 (Metagenome): 27561
Entry
27561             CDS       T30397                                 

Definition
pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide
acyltransferase (E2) component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Best hit
rmu:RMDY18_02190 (best score: 195.282)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.27561-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_28985:2..334
AA seq 111 aa
VRLAAKELGVDLANVTATGARGQVTKQDLMNYVAHLKDVQHSGARQPFWQGATTPGDRIE
RIPVRGVRKATAKAMVASAFSAPHVSIFVDVDASRTMEFVKRLXXXXXXXX

KEGG   T30397 (Metagenome): 19036
Entry
19036             CDS       T30397                                 

Gene name
pdhC
Definition
dihydrolipoyllysine-residue acetyltransferase component of pyruvate
dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Best hit
adc:FOC79_09465 (best score: 120.168)
Taxonomy
Firmicutes - Bacilli [GN:adc]
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.19036-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_23050:complement(479..727)
AA seq 83 aa
MAFQFKMPDIGEGIAEGEIVKIDIKVGDTIQEDDILFEVQNDKSVEEIPSPVSGKVLEVK
VQEGTVARVGDIIVVIXXXXXXX

KEGG   T30397 (Metagenome): 7713
Entry
7713              CDS       T30397                                 

Definition
hypothetical protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Best hit
amy:ADJ76_05915 (best score: 54.6842)
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.7713-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_14579:253..375
AA seq 41 aa
XXXGVRKVVAKRMMESLTTTAQLTLNTTANAAGILAMRKKV

KEGG   T30397 (Metagenome): 27562
Entry
27562             CDS       T30397                                 

Gene name
pdhC
Definition
dihydrolipoyllysine-residue acetyltransferase component of pyruvate
dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Best hit
rmu:RMDY18_02190 (best score: 239.58)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.27562-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_28985:354..728
AA seq 125 aa
XXXXLAAAVIWAAERNPQVNATWTDSEIQIKHYMNLGIAAATPRGLMVPNIKDAQELSLR
ELAIALNNLTTRAREGKTQPAEMANGTLTITNIGSLGIDTGTPIINPGEVAIVAFGTIKQ
KPWVV

KEGG   T30397 (Metagenome): 15227
Entry
15227             CDS       T30397                                 

Definition
putative acetoin dehydrogenase complex, E2 component,
dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Best hit
smf:Smon_1216 (best score: 60.077)
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.15227-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_20298:224..337
AA seq 38 aa
MAVGMDNGLMTPVVYNAEKLSLSELVVAFKDVIGRTLD

DBGET integrated database retrieval system