KEGG   T30397 (Metagenome): 7075
Entry
7075              CDS       T30397                                 

Definition
hypothetical protein
  KO
K01835  phosphoglucomutase [EC:5.4.2.2]
Best hit
pmuc:ING2E5A_1222 (best score: 65.0846)
Pathway
00010  Glycolysis / Gluconeogenesis
00030  Pentose phosphate pathway
00052  Galactose metabolism
00230  Purine metabolism
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
00521  Streptomycin biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS019024.7075-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_14049:complement(173..316)
AA seq 48 aa
TELIRAIAEKSNVILFDCYTGFKWIADVIRKNEGKLNYIGGXXXXXXX

KEGG   T30397 (Metagenome): 9253
Entry
9253              CDS       T30397                                 

Definition
hypothetical protein
  KO
K01835  phosphoglucomutase [EC:5.4.2.2]
Best hit
vpr:Vpar_1545 (best score: 68.1662)
Pathway
00010  Glycolysis / Gluconeogenesis
00030  Pentose phosphate pathway
00052  Galactose metabolism
00230  Purine metabolism
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
00521  Streptomycin biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS019024.9253-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_15790:214..318
AA seq 35 aa
XXXXHRGTSLNGTFTDLHVAAITQAICDGRGQFGA

KEGG   T30397 (Metagenome): 6675
Entry
6675              CDS       T30397                                 

Definition
phosphoglucomutase
  KO
K01835  phosphoglucomutase [EC:5.4.2.2]
Best hit
lpl:lp_0764 (best score: 60.4622)
Pathway
00010  Glycolysis / Gluconeogenesis
00030  Pentose phosphate pathway
00052  Galactose metabolism
00230  Purine metabolism
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
00521  Streptomycin biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS019024.6675-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_13712:complement(3..107)
AA seq 35 aa
XESAKVLVKHGIKAYVFEDLRPTPELSYAVRHLHT

KEGG   T30397 (Metagenome): 4940
Entry
4940              CDS       T30397                                 

Gene name
pgm
Definition
phosphoglucomutase
  KO
K01835  phosphoglucomutase [EC:5.4.2.2]
Best hit
jep:BW721_06790 (best score: 57.3806)
Pathway
00010  Glycolysis / Gluconeogenesis
00030  Pentose phosphate pathway
00052  Galactose metabolism
00230  Purine metabolism
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
00521  Streptomycin biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS019024.4940-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_11732:3..116
AA seq 38 aa
DGSWIAVRPSGTEPKIKFYIGAKADSEEAAKEXXXXXX

KEGG   T30397 (Metagenome): 19520
Entry
19520             CDS       T30397                                 

Definition
hypothetical protein
  KO
K01835  phosphoglucomutase [EC:5.4.2.2]
Best hit
amy:ADJ76_08410 (best score: 77.7962)
Pathway
00010  Glycolysis / Gluconeogenesis
00030  Pentose phosphate pathway
00052  Galactose metabolism
00230  Purine metabolism
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
00521  Streptomycin biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS019024.19520-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_23428:1..126
AA seq 41 aa
AARPSGTEDVYKIYAESFKGAEHLAEVQEAAKKVVSDALNG

KEGG   T30397 (Metagenome): 25176
Entry
25176             CDS       T30397                                 

Gene name
pgm
Definition
alpha-phosphoglucomutase
  KO
K01835  phosphoglucomutase [EC:5.4.2.2]
Best hit
spy:SPy_1224 (best score: 110.923)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00010  Glycolysis / Gluconeogenesis
00030  Pentose phosphate pathway
00052  Galactose metabolism
00230  Purine metabolism
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
00521  Streptomycin biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS019024.25176-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_27402:3..206
AA seq 68 aa
KIVYTPLHGTGEMLARRALAQAGFDSVQVVEAQATPDPDFSTVKSPNPENQAAFALAEEL
GRXXXXXX

KEGG   T30397 (Metagenome): 30568
Entry
30568             CDS       T30397                                 

Definition
phosphoglucomutase, alpha-D-glucose phosphate-specific
  KO
K01835  phosphoglucomutase [EC:5.4.2.2]
Best hit
vpr:Vpar_1545 (best score: 281.567)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00010  Glycolysis / Gluconeogenesis
00030  Pentose phosphate pathway
00052  Galactose metabolism
00230  Purine metabolism
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
00521  Streptomycin biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS019024.30568-T1-C
LinkDB
Position
C913601:2..409
AA seq 136 aa
WIETRANEYVRAYCELEGFKRISIDNIEPDQQVPYDYKGLYVEELSSIINMEAIQSAKPK
VLVNALGGSGLGYWRAIKERYNLNMDIINDEYDPTFSFMTYDHDGKVRMDCSSEYAMADV
IKQIGNYDLAVGNDPD

KEGG   T30397 (Metagenome): 499
Entry
499               CDS       T30397                                 

Definition
hypothetical protein
  KO
K01835  phosphoglucomutase [EC:5.4.2.2]
Best hit
amy:ADJ76_08410 (best score: 67.0106)
Pathway
00010  Glycolysis / Gluconeogenesis
00030  Pentose phosphate pathway
00052  Galactose metabolism
00230  Purine metabolism
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
00521  Streptomycin biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS019024.499-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_1432:complement(3..107)
AA seq 35 aa
XXXDVGQRVAFGTSGHRGSSLDGKFNEAHIIAITA

KEGG   T30397 (Metagenome): 25177
Entry
25177             CDS       T30397                                 

Definition
hypothetical protein
  KO
K01835  phosphoglucomutase [EC:5.4.2.2]
Best hit
spy:SPy_1224 (best score: 31.5722)
Pathway
00010  Glycolysis / Gluconeogenesis
00030  Pentose phosphate pathway
00052  Galactose metabolism
00230  Purine metabolism
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
00521  Streptomycin biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS019024.25177-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_27402:242..301
AA seq 20 aa
XXXATDPDADRVGVEVLQKD

KEGG   T30397 (Metagenome): 15101
Entry
15101             CDS       T30397                                 

Definition
phosphomannomutase
  KO
K01835  phosphoglucomutase [EC:5.4.2.2]
Best hit
spy:SPy_1224 (best score: 83.1889)
Pathway
00010  Glycolysis / Gluconeogenesis
00030  Pentose phosphate pathway
00052  Galactose metabolism
00230  Purine metabolism
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
00521  Streptomycin biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS019024.15101-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_20211:2..148
AA seq 49 aa
GEEAKKRGVAIAYDSRHFSPEFAFESAQVLAAHGIKSYVFESXXXXXXX

KEGG   T30397 (Metagenome): 31812
Entry
31812             CDS       T30397                                 

Definition
phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I
  KO
K01835  phosphoglucomutase [EC:5.4.2.2]
Best hit
ssuy:YB51_4200 (best score: 56.6102)
Pathway
00010  Glycolysis / Gluconeogenesis
00030  Pentose phosphate pathway
00052  Galactose metabolism
00230  Purine metabolism
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
00521  Streptomycin biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS019024.31812-T1-C
LinkDB
Position
C917395:complement(449..571)
AA seq 40 aa
VRPSGTEPKIKFYIAVVGETNEESQAKIANIEAEINAFVK

KEGG   T30397 (Metagenome): 6676
Entry
6676              CDS       T30397                                 

Definition
phosphoglucomutase
  KO
K01835  phosphoglucomutase [EC:5.4.2.2]
Best hit
lpl:lp_0764 (best score: 50.8322)
Pathway
00010  Glycolysis / Gluconeogenesis
00030  Pentose phosphate pathway
00052  Galactose metabolism
00230  Purine metabolism
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
00521  Streptomycin biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS019024.6676-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_13712:complement(192..302)
AA seq 37 aa
IVGPGINRMNIYTVRQATEGLARLIETYGXXXXXXXX

DBGET integrated database retrieval system