KEGG   T30397 (Metagenome): 7830
Entry
7830              CDS       T30397                                 

Definition
hypothetical protein
  KO
K01222  6-phospho-beta-glucosidase [EC:3.2.1.86]
Best hit
soo:FBF35_09000 (best score: 72.4034)
Pathway
00010  Glycolysis / Gluconeogenesis
00500  Starch and sucrose metabolism
Other DBs
HMP: SRS019024.7830-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_14688:228..335
AA seq 36 aa
XXXPGADFVFSAMRVGGTCGRVLDEHCGLDHGLLGQ

KEGG   T30397 (Metagenome): 7829
Entry
7829              CDS       T30397                                 

Definition
hypothetical protein
  KO
K01222  6-phospho-beta-glucosidase [EC:3.2.1.86]
Best hit
soo:FBF35_09000 (best score: 50.8322)
Pathway
00010  Glycolysis / Gluconeogenesis
00500  Starch and sucrose metabolism
Other DBs
HMP: SRS019024.7829-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_14688:2..127
AA seq 42 aa
SLSHHYTYPERMPAMQLTIVGGGGFRVPAMIDVLAXXXXXXX

KEGG   T30397 (Metagenome): 20626
Entry
20626             CDS       T30397                                 

Gene name
bgl
Definition
6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Best hit
aarg:Aargi30884_17880 fro:AALO17_09310 (best score: 129.028)
Taxonomy
Firmicutes - Others [GN:aarg]
Pathway
00010  Glycolysis / Gluconeogenesis
00500  Starch and sucrose metabolism
Other DBs
HMP: SRS019024.20626-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_24222:1..315
AA seq 105 aa
ASSGPQTEGQFDKAHENVMDYWFRTDPEAFFNGVGPDVASDFYHTYPEDFXXXETGEANP
KAVEFYNAVIEEAKKNDIELVLNLHHFDMPVELLQQYXXXXXXXX

KEGG   T30397 (Metagenome): 20627
Entry
20627             CDS       T30397                                 

Definition
hypothetical protein
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Best hit
fro:AALO17_09310 (best score: 50.0618)
Pathway
00010  Glycolysis / Gluconeogenesis
00500  Starch and sucrose metabolism
Other DBs
HMP: SRS019024.20627-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_24222:351..422
AA seq 24 aa
XDKIKYWTTFNEPMVIPEAGYLYA

KEGG   T30397 (Metagenome): 10790
Entry
10790             CDS       T30397                                 

Gene name
bgl
Definition
6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Best hit
aarg:Aargi30884_17880 (best score: 60.077)
Pathway
00010  Glycolysis / Gluconeogenesis
00500  Starch and sucrose metabolism
Other DBs
HMP: SRS019024.10790-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_16980:complement(1..108)
AA seq 36 aa
MDYWYRKSPESFFNQIGPGVASDFYHHYQEDFERMT

KEGG   T30397 (Metagenome): 30255
Entry
30255             CDS       T30397                                 

Definition
6-phospho-beta-glucosidase ascB
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Best hit
sagr:SAIL_12160 (best score: 140.584)
Taxonomy
Firmicutes - Bacilli [GN:sagr]
Pathway
00010  Glycolysis / Gluconeogenesis
00500  Starch and sucrose metabolism
Other DBs
HMP: SRS019024.30255-T1-C
LinkDB
Position
C912573:complement(3..242)
AA seq 80 aa
MTEILQFPEGFLWGGATAANQCEGAYNLDGRGLANVDVVPIGPDREAIITGQKKMFSFEE
DYFYPAKEAIDMYHHYKEDI

KEGG   T30397 (Metagenome): 18303
Entry
18303             CDS       T30397                                 

Gene name
bgl
Definition
6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Best hit
spy:SPy_1328 (best score: 172.94)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00010  Glycolysis / Gluconeogenesis
00500  Starch and sucrose metabolism
Other DBs
HMP: SRS019024.18303-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_22533:complement(1..366)
AA seq 122 aa
XXXIQWSRIFPQGRGEVNPQGVTFYRQVFEAIKAKGILLLVNLYHFDLPFALQEDGDGWE
NKATVKAYEDYARFCFETYGDLVDQWITFNEPIVPVEFGYFYDAHYPHKVDAKAAVKVAY
HT

KEGG   T30397 (Metagenome): 14971
Entry
14971             CDS       T30397                                 

Definition
beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Best hit
rmu:RMDY18_09270 (best score: 88.5817)
Pathway
00010  Glycolysis / Gluconeogenesis
00500  Starch and sucrose metabolism
Other DBs
HMP: SRS019024.14971-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_20120:complement(3..134)
AA seq 44 aa
XXXYRIDYLRQHLHAVREAIEDGVNVLGYTTWGCIDMISASTAQ

KEGG   T30397 (Metagenome): 25262
Entry
25262             CDS       T30397                                 

Definition
beta-glucosidase (gentiobiase) (cellobiase) (beta-D-glucoside
glucohydrolase) (amygdalase)
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Best hit
smf:Smon_1352 (best score: 211.075)
Taxonomy
Fusobacteria [GN:smf]
Pathway
00010  Glycolysis / Gluconeogenesis
00500  Starch and sucrose metabolism
Other DBs
HMP: SRS019024.25262-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_27457:complement(252..632)
AA seq 127 aa
RGYYPNYAKRYFKEHDIEIEFEDGDAELLKNYTVDFLSFSYYMSVTQSALPTQYNSGEGN
IIGGLINPYLESSEWGWQIDPIGLRIILNRYYDRYQIPLFIVENGLGAKDQLIKDEFNNL
XXXXXXX

KEGG   T30397 (Metagenome): 18304
Entry
18304             CDS       T30397                                 

Definition
6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Best hit
aur:HMPREF9243_0291 (best score: 100.523)
Taxonomy
Firmicutes - Bacilli [GN:aur]
Pathway
00010  Glycolysis / Gluconeogenesis
00500  Starch and sucrose metabolism
Other DBs
HMP: SRS019024.18304-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_22533:complement(440..631)
AA seq 64 aa
MLKFPKDFVWGSSTSGPQTEGRVPGDGKGDNLWDYWYQVEPNRYYNGIGPDKTSTFXXXX
XXXX

KEGG   T30397 (Metagenome): 27073
Entry
27073             CDS       T30397                                 

Definition
hypothetical protein
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Best hit
acq:AM609_06010 (best score: 38.1206)
Pathway
00010  Glycolysis / Gluconeogenesis
00500  Starch and sucrose metabolism
Other DBs
HMP: SRS019024.27073-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_28670:complement(548..619)
AA seq 24 aa
SIAWSRIFPLGDETEPNXXXXXXX

KEGG   T30397 (Metagenome): 27072
Entry
27072             CDS       T30397                                 

Definition
hypothetical protein avisC_09161
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Best hit
acq:AM609_06010 (best score: 320.857)
Taxonomy
Actinobacteria [GN:acq]
Pathway
00010  Glycolysis / Gluconeogenesis
00500  Starch and sucrose metabolism
Other DBs
HMP: SRS019024.27072-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_28670:complement(1..525)
AA seq 175 aa
XXXXKHGIEPLVTISHYETPLHLARTYDGWTDRRLIGFFERYARTLFERYGSRVRYWLTF
NEINSVLHEPFLSGGIATPKDRLSEQDLYQAIHHELVASAAATRIAHETNPDIQVGCMIL
AVPTYPLTPDPRDVWAAKQAERANYAFGDLHVRGEYPGYLLRTLRDKGIELEITE

KEGG   T30397 (Metagenome): 15903
Entry
15903             CDS       T30397                                 

Definition
6-phospho-beta-glucosidase bglA
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Best hit
api:100569078 (best score: 58.9214)
Pathway
00010  Glycolysis / Gluconeogenesis
00500  Starch and sucrose metabolism
Other DBs
HMP: SRS019024.15903-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_20791:complement(194..361)
AA seq 56 aa
KNFKIGCMLAMVPFYPNTCDTKDILASQKAMEHRLFHYGDLHVFGERPYXXXXXXX

KEGG   T30397 (Metagenome): 29382
Entry
29382             CDS       T30397                                 

Definition
6-phospho-beta-glucosidase ascB
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Best hit
marr:BKP56_00215 (best score: 194.512)
Taxonomy
Firmicutes - Bacilli [GN:marr]
Pathway
00010  Glycolysis / Gluconeogenesis
00500  Starch and sucrose metabolism
Other DBs
HMP: SRS019024.29382-T1-C
LinkDB
Position
C909681:complement(2..343)
AA seq 114 aa
VSFSYYASLVASGDPEVKELTAGNIFASLKNPYLESSEWGWQIDPLGLRITLNAIWDRYQ
KPMFIVENGLGAMDTPDENGHVADDYRIAYLEAHIKAMRDAIYQDGVDLLGYTT

KEGG   T30397 (Metagenome): 14972
Entry
14972             CDS       T30397                                 

Definition
beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Best hit
rmu:RMDY18_09270 (best score: 90.8929)
Pathway
00010  Glycolysis / Gluconeogenesis
00500  Starch and sucrose metabolism
Other DBs
HMP: SRS019024.14972-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_20120:complement(200..346)
AA seq 49 aa
IDPTGLRVVLNQYWDRWQKPLFIVENGLGARDELVEVNGELTVXXXXXX

DBGET integrated database retrieval system