KEGG   T30397 (Metagenome): 8899
Entry
8899              CDS       T30397                                 

Gene name
fbp
Definition
fructose-1,6-bisphosphatase class 1
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Best hit
rpne:NCTC8284_02583 hin:HI1645 (best score: 58.5362)
Pathway
00010  Glycolysis / Gluconeogenesis
00030  Pentose phosphate pathway
00051  Fructose and mannose metabolism
00680  Methane metabolism
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
04152  AMPK signaling pathway
04910  Insulin signaling pathway
04922  Glucagon signaling pathway
Other DBs
HMP: SRS019024.8899-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_15514:complement(190..327)
AA seq 46 aa
NNYKKGINMKTLSEFIVERQAEYPNAKGELSGILSSIRXXXXXXXX

KEGG   T30397 (Metagenome): 8898
Entry
8898              CDS       T30397                                 

Gene name
fbp
Definition
fructose-1,6-bisphosphatase class 1
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Best hit
rpne:NCTC8284_02583 hin:HI1645 (best score: 55.0694)
Pathway
00010  Glycolysis / Gluconeogenesis
00030  Pentose phosphate pathway
00051  Fructose and mannose metabolism
00680  Methane metabolism
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
04152  AMPK signaling pathway
04910  Insulin signaling pathway
04922  Glucagon signaling pathway
Other DBs
HMP: SRS019024.8898-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_15514:complement(2..112)
AA seq 37 aa
XAHNTMSAALMSREEVAGFASEEEESFIAFDTERARN

KEGG   T30397 (Metagenome): 25664
Entry
25664             CDS       T30397                                 

Gene name
glpX
Definition
fructose-1,6-bisphosphatase, class II
  KO
K02446  fructose-1,6-bisphosphatase II [EC:3.1.3.11]
Best hit
aai:AARI_07650 (best score: 221.861)
Taxonomy
Actinobacteria [GN:aai]
Pathway
00010  Glycolysis / Gluconeogenesis
00030  Pentose phosphate pathway
00051  Fructose and mannose metabolism
00680  Methane metabolism
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.25664-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_27736:complement(250..669)
AA seq 140 aa
VVIGEGEKDKAPMLYNGENVGDGSGPSLDVAVDPIDGTRLTALGMDNALSVIAVADGGTM
FDPSAVFYMEKLVTGPEAAEFVDLRLPVKQNLHLVAKAKGKKVSELTVCVLDRPRHAKLI
QEIRDAGARTRIILXXXXXX

KEGG   T30397 (Metagenome): 25942
Entry
25942             CDS       T30397                                 

Gene name
glpX
Definition
fructose-1,6-bisphosphatase class 2
  KO
K02446  fructose-1,6-bisphosphatase II [EC:3.1.3.11]
Best hit
rpne:NCTC8284_00232 (best score: 86.2705)
Pathway
00010  Glycolysis / Gluconeogenesis
00030  Pentose phosphate pathway
00051  Fructose and mannose metabolism
00680  Methane metabolism
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.25942-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_27912:318..449
AA seq 44 aa
MNRALAIEFSRVTEAAALAAYTWLGRGNKNAADEAAVKAMRYML

KEGG   T30397 (Metagenome): 28322
Entry
28322             CDS       T30397                                 

Definition
hypothetical protein
  KO
K02446  fructose-1,6-bisphosphatase II [EC:3.1.3.11]
Best hit
cgl:NCgl1070 (best score: 43.1282)
Pathway
00010  Glycolysis / Gluconeogenesis
00030  Pentose phosphate pathway
00051  Fructose and mannose metabolism
00680  Methane metabolism
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.28322-T1-C
LinkDB
Position
C906048:219..305
AA seq 29 aa
MIKDIIDVLADPIDGTALTGNDDFTQLIS

KEGG   T30397 (Metagenome): 27563
Entry
27563             CDS       T30397                                 

Gene name
glpX
Definition
fructose-1,6-bisphosphatase, class II
  KO
K02446  fructose-1,6-bisphosphatase II [EC:3.1.3.11]
Best hit
vpr:Vpar_0516 (best score: 461.07)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00010  Glycolysis / Gluconeogenesis
00030  Pentose phosphate pathway
00051  Fructose and mannose metabolism
00680  Methane metabolism
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.27563-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_28987:1..756
AA seq 251 aa
VDPIEGTNLIAKGQNGAIAVMAIAEKGGLLHAPDMYMEKLCVGPRGAGAIDITKSLTENI
KNVAAKMERNVDEITLVMLDRERHQGLMKEAREVGARIMLISDXREVGARIMLISDGDVN
PAMECCIEGSGVHMVVGTGGAPEGVLAAAALKCVGGDMQARLKPETDEEIRRCHEMGIAD
VNQVLTLNDLVRTDDVIFAATAITRGNLLNPIQYFPGGARTHTIVMRSKTGTVRFLDTVH
MDHKLKTLKAK

KEGG   T30397 (Metagenome): 25663
Entry
25663             CDS       T30397                                 

Gene name
glpX
Definition
fructose-1,6-bisphosphatase, class II
  KO
K02446  fructose-1,6-bisphosphatase II [EC:3.1.3.11]
Best hit
rmu:RMDY18_16120 (best score: 69.3218)
Pathway
00010  Glycolysis / Gluconeogenesis
00030  Pentose phosphate pathway
00051  Fructose and mannose metabolism
00680  Methane metabolism
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.25663-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_27736:complement(1..108)
AA seq 36 aa
XXXXGHDLDRVLTTNDLVTSDNCFFAATGITDGKLL

KEGG   T30397 (Metagenome): 14898
Entry
14898             CDS       T30397                                 

Definition
fructose-1,6-bisphosphatase
  KO
K02446  fructose-1,6-bisphosphatase II [EC:3.1.3.11]
Best hit
fnu:FN1159 (best score: 85.5001)
Pathway
00010  Glycolysis / Gluconeogenesis
00030  Pentose phosphate pathway
00051  Fructose and mannose metabolism
00680  Methane metabolism
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.14898-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_20068:2..220
AA seq 72 aa
MGIKVYALPDGDVAGSILTCMIDSDVDMLYGIGGAPEGVISAXXXXXXXXXXXEVKLKVL
LLKMIKYLSLKN

DBGET integrated database retrieval system