KEGG   T30544 (Metagenome): 77065Help
Entry
77065             CDS       T30544                                 

Definition
hypothetical protein
  KO
K14290  exportin-1
Best hit
sht:KO02_03930 pki:111852533 (best score: 31.9574)
Pathway
03008  Ribosome biogenesis in eukaryotes
03013  RNA transport
04013  MAPK signaling pathway - fly
05164  Influenza A
05166  Human T-cell leukemia virus 1 infection
Other DBs
HMP: SRS024580.77065-T1-C
LinkDB All DBs
Position
C2957937:complement(1..354)
AA seq 118 aa AA seqDB search
FCGAVFVYITYVFDMYEYSDINFYRESSNGEIVFRYPLGYVFSTYLPNVFLYVFLSWVVL
RNHKLSVFEFIFLSFLNYVLYDFTDTRTVFYLVNLLIFVLIFMRMFNIDYKTKLLGRV

DBGET integrated database retrieval system