KEGG   T30595 (Metagenome): 1073
Entry
1073              CDS       T30595                                 

Gene name
pbp1A
Definition
penicillin-binding protein 1A
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Best hit
ppe:PEPE_0931 (best score: 392.504)
Taxonomy
Firmicutes - Bacilli [GN:ppe]
Pathway
00550  Peptidoglycan biosynthesis
01100  Metabolic pathways
01501  beta-Lactam resistance
Other DBs
HMP: SRS047335.1073-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_213:complement(736..2073)
AA seq 445 aa
MSENKNSSERNTRSSKYHKNKKEKHLGWLVLKLILLFVVVIIVSGVGLFAYYAKDAPSIS
KAQLQSGGTSSLYTTDGKFLLSLGSEKRIYVDDKHIPQKLKDAVISVEDKRFYSEGFGLD
PVRIVGSVLVNARAKGVAAGGSTITQQLVKLSVFSTAMSQRTLKRKAQEAWLSMKVEREF
SKKQILEFYINKVYMNYGNYGMGTAADFYYGKPLKDLNLAQTALIAGMPNAPISYDPYVY
PKKAKYRRDIVLYSMLKNKKISLAQYNAAVKVPITEGLLSKKDKVNSNLRKVDDPYIKEV
INEVKEKGFNPYNDNLKITININQHIQQKLYDLANNGEVPFTNDKMQIGATIIDPNNGHV
VAILGGRKLPAVQLGLNRAVQTARSTGSTIKPVLDYAPAIEYLKWSTSHIINDSKYIYPG
TKXXXXXXXXXXXQKSWFSSCITFC

KEGG   T30595 (Metagenome): 3633
Entry
3633              CDS       T30595                                 

Definition
penicillin-binding protein, 1A family
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Best hit
ppe:PEPE_0931 (best score: 614.379)
Taxonomy
Firmicutes - Bacilli [GN:ppe]
Pathway
00550  Peptidoglycan biosynthesis
01100  Metabolic pathways
01501  beta-Lactam resistance
Other DBs
HMP: SRS047335.3633-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_935:complement(1559..3934)
AA seq 791 aa
MADNNQKPTNSRMANLHPEGKPRKKIWLQIIKWFFIVAMLIIVSGVGLFAYYAKDAPSIS
QAQLQSGGTSRLYTRDGKFLLSLGSEKRTYVNNDEIPKELKNAIVSVEDRRFYKEGIGLD
PIRIVGSVLVNAKSKGVAAGGSTITQQLVKLSVFSTAASQRTLRRKAQEAWLSMKVEREF
SKEQILEFYINKVYMNYGNYGMGTAADFYYGKDLKDLDLAQTALLAGMPNAPVTYDPYVY
PEKAKYRRDIVLRAMLKNDKITKSQYTQAVNEPITQGLQPKKNNATSELRKVDDPYIKEV
ISEVKSKGFNPYNDNLKITVNIDQDAQQKLYDLVNNGSVPFTNDKMQVGATIIDPRTGHV
IAIIGGRKLPSVQLGLNRAVQTGRSTGSTVKPVLDYGPAIEYLNWPTSHILDDSKYVYPG
TNIQLYDWDNKYEGKMTMRHALEQSRNVPAVKTLSKVGVARASLFARKLGVNVPSDSGLS
VAIGANASSLQMAGAFGAFANNGVYHKPQFVSKIETPDGLTRNYDSSGTRVMKESTAYIM
TDMLKGVLTKGSGTQARIKNLYEAGKTGTVKYSDEELVKYPQYKNSPKDSWFVGYTKLYS
MGIWTGYDNLKDGTPSGVGSSSAQLLYKQMMSYLMTDKANKDWTKPSTVVRRRIANGTQD
KVVSPTASNSSWQLFVKGHAPKNPYSEVTVDKRKDEDDDVDTRFDTEDDTSSKGQSHSQS
SSSSSHAEQQSSSQKQSSTSNNNNSNNQNQNNNQQTENKSNNQNNNSQQNTNNQNNQNQQ
QNQGNNSNNNH

KEGG   T30595 (Metagenome): 5455
Entry
5455              CDS       T30595                                 

Definition
membrane carboxypeptidase
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Best hit
thl:TEH_13490 (best score: 88.9669)
Pathway
00550  Peptidoglycan biosynthesis
01100  Metabolic pathways
01501  beta-Lactam resistance
Other DBs
HMP: SRS047335.5455-T1-C
LinkDB
Position
C126923:complement(2..373)
AA seq 124 aa
MAENNHRSASNTAPKNSRMANLHHDSGQPKRRLWLQILKWFSIGILLILVSGVGLFAYYA
KDAPSISQDQLQSGGSSSFYTSDGKFLLSLGSEKRTYVKNSDIPQTLKDAVVSVEDKRFY
QENL

KEGG   T30595 (Metagenome): 1072
Entry
1072              CDS       T30595                                 

Gene name
ponA
Definition
penicillin-binding protein 1A
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Best hit
lpl:lp_1751 (best score: 182.185)
Taxonomy
Firmicutes - Bacilli [GN:lpl]
Pathway
00550  Peptidoglycan biosynthesis
01100  Metabolic pathways
01501  beta-Lactam resistance
Other DBs
HMP: SRS047335.1072-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_213:complement(3..839)
AA seq 279 aa
MIVNIYIQVQKXXXXXXXXXXLKKVGLARASLFVRKMGINIPSDSGLSVGIGANASTLQM
ASAYAAFANNGRYYKPQFVSKIETPDGITRNYDSSSTKVMKESTAYMITDMLKGVFTRGS
GIMAKCDNIYEAGKTGTVKYSDEDLVKFPSYAHTPKDSWFIGYTKAYSIGIWTGYDNLKD
GTISGIGENSAQLFYKKMMTYLMKNKPNSNWKKPSTVVRCRIVNGTERKVASKHSKNYTW
QLFVKGHAPAPDDNDDDVDNIDDSDDKVNTADEDADKDN

KEGG   T30595 (Metagenome): 3424
Entry
3424              CDS       T30595                                 

Definition
penicillin-binding protein 1A/1B
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Best hit
ppe:PEPE_0931 lpl:lp_1751 (best score: 520.005)
Taxonomy
Firmicutes - Bacilli [GN:ppe]
Pathway
00550  Peptidoglycan biosynthesis
01100  Metabolic pathways
01501  beta-Lactam resistance
Other DBs
HMP: SRS047335.3424-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_894:3..1862
AA seq 620 aa
FYQENLGIDPIRIVGSIVSNAKSSGIAAGGSSITQQLVKLTVFSTAASQRTLKRKAQEAW
LAIRVEHDYTKNQILEYYINKVYMNYGVYGMGTAADYYYGKSLKDLDLAQTALIAGMPNA
PVAYDPYTYPKAAKYRRDIVLNAMYANGKISKAQLKAAKAESITQGLKTQQNSSESSIRK
IDDPYIKEAISEVKSKGYDPYNDNLKITLNIDQDAQNKLYELANGSSIPFSSSKMQVGAT
IINPSNGHVVAIIGGRNLPSVQLGLDRAVQTGRSTGSSIKPVLDYAPAIEYLNWSTAHYL
EDTKYVYPGTSIQLYDWDNKYMGKMTMRYALEQSRNVPAVKTLAKVGMKKASLFAKKMNI
SVGSNQGLSVAIGANASSLQMAGAYAAFANEGVYYKPQFVSQIETADGVVHSYSATGTRV
MKKSTAYMITDMLKGVLTEGSGTNARTGLYEAGKTGTVKYSDDELVKYPSYANTPKDAWF
VGYTKKYSIGIWTGYDNLSDGTISGQGQYASQYLYKYMMKYLMSDKENSNWTKPSNVVRK
RIVKGSDPLEVTSSKKNSTSELFLRGHTPDGSNEDSDESSSSSNSSSSSKDNEVVTNKSS
SSSSSSSSEGHEDGSTSNSS

KEGG   T30595 (Metagenome): 1487
Entry
1487              CDS       T30595                                 

Definition
membrane carboxypeptidase
  KO
K03693  penicillin-binding protein 1B
Best hit
ljo:LJ_0492 (best score: 1625.53)
Taxonomy
Firmicutes - Bacilli [GN:ljo]
Pathway
00550  Peptidoglycan biosynthesis
01100  Metabolic pathways
01501  beta-Lactam resistance
Other DBs
HMP: SRS047335.1487-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_370:complement(9182..12010)
AA seq 942 aa
VKNLKEKIIEFLTAGPEVKTLQSKSDESQWKFYSGIVYLTLRRVFHYLILIAVFGLFLLI
GFGGGYALGIVRQQPIPTISELNQQINHAQNSATLYYAGNKKIATVRPDTVTKKASESEL
TPLVKNAVTATEDENFYIHKGVLPKSLVRAVLSELTGVGVQTGGSTLTQQLVKMQFLTSQ
TTWRRKVTEMFYAHKIEKHFSKEDILRSYLNAAPYGKNNRGENIVGIKTAAQGIFGKSIS
ELNLPQAAFIAGLPQSPSVYTPYRLNGKIKKDLDLAMRRKDIVLFRMYRNGDISKKDYLA
AKKYDLRADFLAPEKASKQKKQSGYLYNLVMNKSTSLLAEKLIEQDGLKVSDVKQDTNRY
NQYLTSATELLHQKGYHIKTTIRQPLYQTMQRIVKQNKYGQDKTSRDFDSSTNKWVNTTE
HVENGSVVIDNATGKVLAFSGGVDFKNSQINHAFDTYRSPGSSIKPYLVYGPAIEHRFIS
SQTALADFPTRFGNYIPTDYNSTVENRFILAQEALSKSYNLPAVNLYNKLVNDKNINLRQ
DMKKLGLNLSKSEFENLGLALGGTDYGFSVADNASAFSNFYNNGKRADPYYIEEIQDPSG
RVIYKHKQNPQKVFSTGTSYIMQKMLHQVVTKGTASSLTGTLKFNYKNLIGKTGTSNDYR
DIWFNGSTPGITISSWMGYDNFYGHSYNLDSNSSETNLNLWANIANALYEEDPSIFKLND
APSRPSSVYKNKVLARTGTLPGTVSYDGDNIELSGKKTTALSLSPAPAATARFGIGGSTK
DYNLFYDYLEGKNNDYGKVLIYTGKTISKKKNINSLFAVADGSTSEDAKNYYGKNHEVYR
ESNNNSSSSTNRTVGANDQQARSTGQGGNGNGSSSSTSTRRSRASSTSESSSSTENSNSE
SNNAANDVNSNISSNEGSAANTNTGSETSEGNTATDSGPTAP

KEGG   T30595 (Metagenome): 2430
Entry
2430              CDS       T30595                                 

Definition
penicillin-binding protein 1F
  KO
K12555  penicillin-binding protein 2A [EC:2.4.1.129 3.4.16.4]
Best hit
ppe:PEPE_0672 (best score: 458.373)
Taxonomy
Firmicutes - Bacilli [GN:ppe]
Pathway
00550  Peptidoglycan biosynthesis
01100  Metabolic pathways
01501  beta-Lactam resistance
Other DBs
HMP: SRS047335.2430-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_643:1336..2457
AA seq 374 aa
MREYSRNKKANPVWLFIKNINHRFQVIRWLVLALLTVILITSSYYTIKVKTSNIANLKAS
LATTTQIYDASGQKAGNLYSQKGTFVELDKISPYMQEAVISTEDRTFYTNPGFSIKGMAR
AFVSLLIHHGNIAGGGSTLTQQLAKNAILTQQQTFSRKLEELFFAIEINHVYSKKDILTM
YLNNAYFGNGVWGVQDASHKYFGKDASDLTVGEAATLAGMLRNPSYYNPIDHMTNALSRR
NVVLGLMVQNKKLSASSCKIAQSESLSLKDNYTQDDGYKYPYFFDAVVDEAISKYGLTEE
DVMNKGLKIYTTLNTDYQSAMQDSFDSSANFPASASDGTKVQGASVAVDPKSGAVRAIVG
GRGEHVFRGYNRAT

KEGG   T30595 (Metagenome): 2412
Entry
2412              CDS       T30595                                 

Gene name
pbp2A
Definition
penicillin-binding protein 2A
  KO
K12555  penicillin-binding protein 2A [EC:2.4.1.129 3.4.16.4]
Best hit
lpl:lp_1413 (best score: 410.223)
Taxonomy
Firmicutes - Bacilli [GN:lpl]
Pathway
00550  Peptidoglycan biosynthesis
01100  Metabolic pathways
01501  beta-Lactam resistance
Other DBs
HMP: SRS047335.2412-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_636:complement(3..995)
AA seq 331 aa
MVRALLMSMLHRGIVGGGSTLTQQLAKNALLTQKQTISRKIEELFFAIEINHVYSKRDIL
TMYLNNAYFGNGVWGVQDASKRYFGKNASELNISEAATLAGMLKSPSYYNPIDHMQNALN
RRNTVVNLMLQNKKITKSEADNAQSSVLSLKNTFRQKSGYRYPYFFDAVVDEAIHRYGLK
EEDVMNKGLKIYTTLDQSYQKAIQDSFEIDGNFPATAADGVMPQGASVAVDPKTGAIRAV
VGGRGRHVFRGYNRAMQMKRQPGSSLKPLAVYAPALQNGYHYDTSLSNKLQKFGKNGYEP
HNVDNQYSDTIPMYQAVADSKNVPAVWLLDK

KEGG   T30595 (Metagenome): 3093
Entry
3093              CDS       T30595                                 

Definition
penicillin-binding protein, 1A family
  KO
K12555  penicillin-binding protein 2A [EC:2.4.1.129 3.4.16.4]
Best hit
lpl:lp_1413 (best score: 674.855)
Taxonomy
Firmicutes - Bacilli [GN:lpl]
Pathway
00550  Peptidoglycan biosynthesis
01100  Metabolic pathways
01501  beta-Lactam resistance
Other DBs
HMP: SRS047335.3093-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_828:3..1748
AA seq 581 aa
TFYKNPGFSVKGMARAAISSVIHHGIVGGGSTLTQQLAKNALLTQKQTFSRKLEELFFAI
EINRVYSKKDILTMYLNNAYFGNGVWGVQDAARRYFGKNASDVTVGEAATIAGMLRSPSY
YNPIDHMDNAISRRNVVLGLMADTGKISETQADNAKKTTLTLEDTFSQEDGYRYPYFFDA
VVDEAIDRYGLKEEDVMNKGLKIYTTLDTGYQSALQDSFEESWNFPSNASDGTKVQGASV
AMDPKTGAVRAIVGGRGQHVFRGYNRATQMKRQPGSTMKPLAVYSPALQSGYHYDSELSN
KLQKFGKNGYEPKNVDNQYSNKIPMYEALAQSKNVPAVWLLDKIGVSKGVQSVENFGIHV
NKSDQNLALALGGLSTGVSPMQMARAYSAFANEGNLPNQSYCITKITDASGNVIAQNKNP
GSHRIISTNTAKEMTSMLLGVFTSGTGRSAQPANFRVAGKTGSTEVPDSYGFGTKDQWIV
GYTPDVVLSTWVGFDKTDQNHYMEGISETGITHLYKSELERLLPYTSQTQFKEKSAQQIS
QDTGANSDWLGNIGKQVQKGINDTGSKFNEWYNNLKGLLGQ

KEGG   T30595 (Metagenome): 1710
Entry
1710              CDS       T30595                                 

Gene name
pbp2A
Definition
penicillin-binding protein 2A
  KO
K12555  penicillin-binding protein 2A [EC:2.4.1.129 3.4.16.4]
Best hit
lpl:lp_1413 (best score: 155.606)
Taxonomy
Firmicutes - Bacilli [GN:lpl]
Pathway
00550  Peptidoglycan biosynthesis
01100  Metabolic pathways
01501  beta-Lactam resistance
Other DBs
HMP: SRS047335.1710-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_467:1..537
AA seq 178 aa
TDANGKVISQKSNDRYHRIISHRVAEEMTMMLLGVFSNGTAVSAQPAGYEVAGKTGSTEV
PNSYGFGTKDQWIVGYTPDIVVATWVGFDKTDKEHYMHGISENGITRLYKSQMESLLPNS
PLTKFKVKSAQQNEYASHTDDNDLKSSDSFQDKIKKGIDGLGKKVTEWYNDLKGLFKH

KEGG   T30595 (Metagenome): 5757
Entry
5757              CDS       T30595                                 

Definition
penicillin-binding protein 1F
  KO
K12555  penicillin-binding protein 2A [EC:2.4.1.129 3.4.16.4]
Best hit
lpl:lp_1413 (best score: 209.92)
Taxonomy
Firmicutes - Bacilli [GN:lpl]
Pathway
00550  Peptidoglycan biosynthesis
01100  Metabolic pathways
01501  beta-Lactam resistance
Other DBs
HMP: SRS047335.5757-T1-C
LinkDB
Position
C127473:2..628
AA seq 208 aa
GGLSTGVSPLQMAKAYSAFANNGNLPNNAYFITKIEDASGNVIAQNSNTGSHRIMSQSVA
KEMTSMLLGVFTSGTAQSAQPSGYQVAGKTGSTEVSWAYGTKDQWIVGYTPDVVVATWVG
FDKTDQNHYMQGISETGITRLYKAEMEGILPYTKGTAFSEKPAQSMANSTGSDSDWLSQA
GQNLQNGLNQAGKNIQAWYNNIKGLFGK

DBGET integrated database retrieval system