KEGG   T30595 (Metagenome): 121
Entry
121               CDS       T30595                                 

Gene name
ffh
Definition
signal recognition particle protein
  KO
K03106  signal recognition particle subunit SRP54 [EC:3.6.5.4]
Best hit
ppe:PEPE_0846 (best score: 572.007)
Taxonomy
Firmicutes - Bacilli [GN:ppe]
Pathway
02024  Quorum sensing
03060  Protein export
03070  Bacterial secretion system
Other DBs
HMP: SRS047335.121-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_36:2..1414
AA seq 470 aa
SERLQKALKNLTGKGKISEADINDASREIRLALLEADVNFKVVKDFIKKIKKEALGKEVQ
ESLNPGQQIIKIVDDELTKMMGEEAVSLNKSQHIPTIIMMVGLQGTGKTTTVGKLANYLM
KNEKARPLLIAGDIYRPAAIDQLKQIGQQLNVPVYSEDNQDVAEIVKHGLEEADKNKNDY
VLIDTAGRLEIDEQLMDELKRVTAVAHPDNTLLVVDAMTGQAATQVAEGFNNDLDLTGII
LTKLDGDTRGGAALSIRAVTGLPIIFTGQGEKLTDLSTFHPDRMASRILGMGDMLTLIEK
AQQDYDAKEAEKMAEKMRENTFDFNDFIDQMDQVQKMGPLDQIIKMIPGLGNNPALKNIQ
IPEKQISHIKAIVYSMTPEERENPDILNPSRRRRIAAGSGRSIAEVNRMIKQFKQSKEMM
QKMTKGDMGEFANLPGMNSPMGKMAMRSMNKRFKKNKKKRMKKIKRYRSK

KEGG   T30595 (Metagenome): 3844
Entry
3844              CDS       T30595                                 

Gene name
ffh
Definition
signal peptide binding domain
  KO
K03106  signal recognition particle subunit SRP54 [EC:3.6.5.4]
Best hit
ppe:PEPE_0846 (best score: 108.227)
Taxonomy
Firmicutes - Bacilli [GN:ppe]
Pathway
02024  Quorum sensing
03060  Protein export
03070  Bacterial secretion system
Other DBs
HMP: SRS047335.3844-T1-C
LinkDB
Position
C121036:complement(1..309)
AA seq 103 aa
ALKNFKVPDKQIAHTKAIVYSMTPAEREDPDLLNPSRRRRIAGGCGLSVVEVNRMIKQFK
QAKDMMQKVTSGNFKGLSNLPGMDTPMAKMAMKSMSKNFKKNK

KEGG   T30595 (Metagenome): 3415
Entry
3415              CDS       T30595                                 

Gene name
ffh
Definition
signal peptide binding domain
  KO
K03106  signal recognition particle subunit SRP54 [EC:3.6.5.4]
Best hit
lpl:lp_1635 (best score: 248.054)
Taxonomy
Firmicutes - Bacilli [GN:lpl]
Pathway
02024  Quorum sensing
03060  Protein export
03070  Bacterial secretion system
Other DBs
HMP: SRS047335.3415-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_891:3..521
AA seq 173 aa
EIDDQLMDELKNIVDVAHPENIILVADAMTGQVAATVAEGFNSKLKLTGLILTKLDGDTR
GGAALSIREVTGLPILFTGQGEKLTELDTFHPDRMASRILGMGDMLSLIEKAQQDFDAKE
AEKVAQKMRENTFDFNDFVDQMDQMQKMGPLDQIIKMIPGMANNPALKNFKVP

KEGG   T30595 (Metagenome): 3657
Entry
3657              CDS       T30595                                 

Gene name
ffh
Definition
signal peptide binding domain
  KO
K03106  signal recognition particle subunit SRP54 [EC:3.6.5.4]
Best hit
lpl:lp_1635 (best score: 109.768)
Taxonomy
Firmicutes - Bacilli [GN:lpl]
Pathway
02024  Quorum sensing
03060  Protein export
03070  Bacterial secretion system
Other DBs
HMP: SRS047335.3657-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_944:complement(1870..2214)
AA seq 114 aa
LKNFSIDEKQIAHTKAIVYSMTEAERQDPDLLNPSRRRRIAAGSGRPIMEVNRMIKQFKQ
SKEMMQKITSGNTKALAGLPGMDSPMAQAAMRRMGKQFKKGKKKRLKHIKRFKS

KEGG   T30595 (Metagenome): 6142
Entry
6142              CDS       T30595                                 

Gene name
ffh
Definition
signal recognition particle protein
  KO
K03106  signal recognition particle subunit SRP54 [EC:3.6.5.4]
Best hit
efa:EF1700 (best score: 458.759)
Taxonomy
Firmicutes - Bacilli [GN:efa]
Pathway
02024  Quorum sensing
03060  Protein export
03070  Bacterial secretion system
Other DBs
HMP: SRS047335.6142-T1-C
LinkDB
Position
C128019:complement(1..1050)
AA seq 350 aa
MAFENLSERIQKALKNLTGKGKVSEADINAASREIRLALLEADVNFKVVKDFIKKIKERA
LGQEVQGSLTPGQQIIKIVNDELTKMMGEEAAKLNKAPHIPTIIMMVGLQGTGKTTTVGK
LAKYLMDTEKARPLLIAGDIYRPAAIDQLKQIGDQLSVPVFSEDEKDVAKIVADGLAQAK
EAKNDYVLIDTAGRLEIDEALMEELERVKAVAKPDNIVLVVDAMTGQVGAQVAETFDKRL
DVTGVILTKLDGDTRGGAALSIRAVTGKPILFTGQGEKLSELEGFYPDRMASRILGMGDV
LTLIEKAQRDYDAKEAEKVAQKMRENTFDFNDFIDQLEQVQKMGPLDQIM

KEGG   T30595 (Metagenome): 1469
Entry
1469              CDS       T30595                                 

Gene name
ffh
Definition
signal recognition particle protein
  KO
K03106  signal recognition particle subunit SRP54 [EC:3.6.5.4]
Best hit
tvu:AB849_009935 (best score: 149.828)
Taxonomy
Firmicutes - Bacilli [GN:tvu]
Pathway
02024  Quorum sensing
03060  Protein export
03070  Bacterial secretion system
Other DBs
HMP: SRS047335.1469-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_368:complement(1..363)
AA seq 121 aa
MAFENLSEKLQKALRKLTGKGKISENDINQASREIRLALLEADVNFKVVKKFIKTIKAEA
LGKEVQESLNPGQQIIKIVNDELTKMMGSDTASIIEAKHIPTIIMMVGLQGTGKTTTVGK
L

DBGET integrated database retrieval system