KEGG   T30595 (Metagenome): 1255
Entry
1255              CDS       T30595                                 

Definition
hypothetical protein
  KO
K04350  RAS guanyl-releasing protein 1
Best hit
ncc:104953027 (best score: 27.7202)
Pathway
04010  MAPK signaling pathway
04014  Ras signaling pathway
04611  Platelet activation
04660  T cell receptor signaling pathway
05200  Pathways in cancer
05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Other DBs
HMP: SRS047335.1255-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_301:complement(337..492)
AA seq 51 aa
MLVDGVRAKXXXXXXXRYMCKKYISTLEEVKKKVPHELNIRGFMEHEFCEX

DBGET integrated database retrieval system