KEGG   T30595 (Metagenome): 1325
Entry
1325              CDS       T30595                                 

Gene name
pgk
Definition
phosphoglycerate kinase
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
Best hit
ppe:PEPE_0460 (best score: 358.992)
Taxonomy
Firmicutes - Bacilli [GN:ppe]
Pathway
00010  Glycolysis / Gluconeogenesis
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04066  HIF-1 signaling pathway
Other DBs
HMP: SRS047335.1325-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_325:20075..20782
AA seq 236 aa
MAKLIVSDLDLKGKKVLVRVDFNVPIKNGVIGDDNRIVAALPTIKYIIEHGGKAILLSHL
GRVKSDADKKELSLRPVAERLSELLKKPVTFVPENEGKEVEETIDKMKDGDVIVLENTRF
QDIDNDFGKRESKNDPKLGEYWASLGDVFVNDAFGTAHRSHASNVGIATAMKKAGKPAAA
GFLLEKEIKFLGDAVENPVHPFVTILGGAKVSDKIGVIENLIPKSDHILIGGGMAY

KEGG   T30595 (Metagenome): 905
Entry
905               CDS       T30595                                 

Gene name
pgk
Definition
phosphoglycerate kinase
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
Best hit
ppe:PEPE_0460 (best score: 253.447)
Taxonomy
Firmicutes - Bacilli [GN:ppe]
Pathway
00010  Glycolysis / Gluconeogenesis
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04066  HIF-1 signaling pathway
Other DBs
HMP: SRS047335.905-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_151:complement(58755..59279)
AA seq 174 aa
IGGGMAYTFLAAQGHKIGKSLFEADKVELAKELLAKAGDKIVLPVDNVAATEFSNDAPHE
VVGDDIPDNEMGLDIGPKTVEKFRDILKDAKTVVWNGPMGAFEMPNYAEGTLEVGRALAD
LKDAVTIIGGGDSTAAAKQLGIAPKISHISTGGGASLNYLEGKELPGIACVSDK

KEGG   T30595 (Metagenome): 5129
Entry
5129              CDS       T30595                                 

Gene name
pgk
Definition
phosphoglycerate kinase
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
Best hit
css:Cst_c20800 (best score: 58.151)
Pathway
00010  Glycolysis / Gluconeogenesis
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04066  HIF-1 signaling pathway
Other DBs
HMP: SRS047335.5129-T1-C
LinkDB
Position
C126262:complement(855..950)
AA seq 31 aa
PKITHISTGGGASLEYLEGKELPGIECISDK

KEGG   T30595 (Metagenome): 1339
Entry
1339              CDS       T30595                                 

Gene name
pgk
Definition
phosphoglycerate kinase
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
Best hit
ppe:PEPE_0460 (best score: 402.134)
Taxonomy
Firmicutes - Bacilli [GN:ppe]
Pathway
00010  Glycolysis / Gluconeogenesis
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04066  HIF-1 signaling pathway
Other DBs
HMP: SRS047335.1339-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_332:complement(2..880)
AA seq 293 aa
MAKLIVSDLKDLEGKKVLVRVDFNVPIKNGVISDDNRIVAALPTIKYIIEHGGKAILLSH
LGRVKSDADKKELTLKPVAERLSELLEKPVTFVPENEGKEVEDAVAAMKNGEVIVLENTR
FQDIDNDFGKRESKNDPTLGEYWASLGDVYVNDAFGTAHRSHASNTGIATAMKAAGKLAA
AGYLMEKEIKFLGNAVSNPVHPFVTILGGAKVSDKIGVITNLIPKSDHILIGGGMAYTFL
AAQGHKIGKSLFEEDKVELAKELLAKAGDKIVLPVDHVAATEFSNDATHEVVD

KEGG   T30595 (Metagenome): 3791
Entry
3791              CDS       T30595                                 

Gene name
43
Definition
DNA polymerase
Best hit
vg:26042014 (best score: 162.155)
Taxonomy
Viruses [GN:vg]
Other DBs
HMP: SRS047335.3791-T1-C
LinkDB
Position
C120826:complement(3..230)
AA seq 76 aa
MEEFYISIETVGNNIVERYIDENGKERTREVEYLPTMFRHCKEESKYKDIYGKNCAPQKF
PSMKDARDWMKRMEDI

KEGG   T30595 (Metagenome): 5057
Entry
5057              CDS       T30595                                 

Gene name
pgk
Definition
phosphoglycerate kinase
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
Best hit
ppe:PEPE_0460 (best score: 395.586)
Taxonomy
Firmicutes - Bacilli [GN:ppe]
Pathway
00010  Glycolysis / Gluconeogenesis
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04066  HIF-1 signaling pathway
Other DBs
HMP: SRS047335.5057-T1-C
LinkDB
Position
C126066:complement(2..877)
AA seq 292 aa
KDVEFVPSNEGKEVEDAIAKMNDGDVLVMENTRFQDIDNDFGKRESKNDPKLGEYWASLG
DLYVNDAFGTAHRSHASNVGIATAMKAEGKKVAAGFLMEKEIKFLGNAIANPVHPFVTIL
GGAKVSDKISVITNLIPKSDHILIGGGMAYTFLAAQGHKIGKSLFEADKVELAKELLEKA
NGKIVLPVDNVAATEFSNDASREVVGDDIPDNEMGLDIGPKTVELFRKTLQGAKTVVWNG
PMGCFEMPNFAEGTLEVGRAMADLPDATTIIGGGDSTAAAKQLGIAPKITHI

DBGET integrated database retrieval system