KEGG   T30595 (Metagenome): 1524
Entry
1524              CDS       T30595                                 

Definition
hypothetical protein
  KO
K00868  pyridoxine kinase [EC:2.7.1.35]
Best hit
crn:CAR_c05930 (best score: 141.739)
Taxonomy
Firmicutes - Bacilli [GN:crn]
Pathway
00750  Vitamin B6 metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS047335.1524-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_381:2194..3048
AA seq 284 aa
MQKMLIIEDLSALGQISMVSAISVATIMNVKPALLPTIILSTQSEGFGAPVSLTLEQWQN
KAIEHWNNLEQEFDTMMIGYIGCISGVQNILSFLPLIRKKKLVVDPAMADQGSLYPNLPL
TYPSMISTLCQYADVIVPNFTEACLLAQVDYANDSLNQSKLNQLVDKLVQRFPSTEIIIT
GVPLANKLAVVYVNKLNIASPMLWSVESIARHFYGTGDIFTAIVSACLAKKMSTEKAVKI
AINALELAVKDSAQLTDHELLYGLKMTRLQEYLLDIEGNEIDEK

KEGG   T30595 (Metagenome): 2902
Entry
2902              CDS       T30595                                 

Definition
pyridoxal/pyridoxine/pyridoxamine kinase
  KO
K00868  pyridoxine kinase [EC:2.7.1.35]
Best hit
ccel:CCDG5_0809 (best score: 184.111)
Taxonomy
Firmicutes - Clostridia [GN:ccel]
Pathway
00750  Vitamin B6 metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS047335.2902-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_780:9208..10035
AA seq 275 aa
MEEKILVSQDLSCLGQVSLSVALPILGACGYQPDVLPTAILSTHTGGFGDNTFLNLNSEM
SKIIAHWRDQKIDFKNLYLGYLGKEAIDFWLSHISDFKDSNVLLDPAMADSGKLYHGLDT
DYVTKMRILAKSATILTPNLTEACLLLGKNYRDFSINEIKKLALELKERFKLKEVVITGI
LMKEKIKMVGVSANDQVFVIENEKVGRSFFGTGDMFASSLLVAILAGYSLKEGVEIAATF
IKMAIEVTDLTQDKRLGPNYAGALPWLMNKSRERG

DBGET integrated database retrieval system